KEGG   Edwardsiella tarda EIB202: ETAE_1732Help
Entry
ETAE_1732         CDS       T01121                                 

Definition
(GenBank) hypothetical protein
Organism
etr  Edwardsiella tarda EIB202
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1843273..1843464
Genome map
AA seq 63 aa AA seqDB search
MMRRVHGARYVDRVRFIGPALVVATPLALASLREICASINMITLLIFSIDTFCAHKKCSR
RLY
NT seq 192 nt NT seq  +upstreamnt  +downstreamnt
atgatgcgccgtgttcacggtgccagatatgttgaccgggtacgttttatcggccctgcg
ctggtcgtcgcgaccccccttgcattggcgtcgctacgtgaaatctgcgcgtcgattaac
atgattaccctgctgattttctctatcgacaccttctgtgcccataaaaaatgcagccgt
cggctatattga

DBGET integrated database retrieval system