KEGG   Edwardsiella tarda EIB202: ETAE_1735Help
Entry
ETAE_1735         CDS       T01121                                 

Definition
(GenBank) methyl-accepting chemotaxis protein
  KO
K03406  
methyl-accepting chemotaxis protein
Organism
etr  Edwardsiella tarda EIB202
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:etr00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    ETAE_1735
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    ETAE_1735
Bacterial motility proteins [BR:etr02035]
 Flagellar system
  Chemotaxis proteins
   MCPs
    ETAE_1735
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1844307..1846097)
Genome map
AA seq 596 aa AA seqDB search
MFDSIRARILATTGVIVAASLCVNTLINYRIASDSNAEAIQHTLSSLTASHTATVRQWVE
NNTALIASLTPHVGDSDPRPLLKQIADAGGFISVDMGYSNKVEISSDPASIPPGFDPTTR
AWFINARKAGHPIVTEPYMDANTHTLVVTFAAPGPQDTPISGVVEGDVHMDKVIANVRSI
RPTENSFGMLLNADGTIIAHPNQQLTLKPLANIAPGLSLTQLLTSGKPVEATVSGRDVLL
LAMPVSGTSWYTVVAMDKTEATAGMRSLLLASCIALLVLIVLATLVIGIVTRRALRPLFH
IRQAMENIGAGNNADLTKRLDVQGKDEVSQIARAFNQFVDKLARVMVSIHSTSESVRIAA
REIAAGNEDLSCRTESAAASLQQTSAALEQISSTVAQSATSAQQANEAVSSAVQVAQRGG
KMISQVIETMSSIEVASGKIGDITGVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVAG
EVRTLAQRSAQAAKEIKNLIDSTVTSVASGSHQVRQSGETMTDIVNSVGAVSAIMGEITN
AAEEQNRGISEINSAVIQLDTMVQQNAALVEESTAASAALQGQASELADTVGQFRM
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
atgttcgattccattcgggcacggatcctcgcgacaaccggcgtcattgtcgcggcgtcg
ctttgtgtcaatacgttgattaattaccgcattgccagcgactccaacgcagaagccatt
caacataccctaagctctttaaccgctagccataccgccaccgtacgtcagtgggtggaa
aacaacacggcgctgatcgcgtcgctgacgccccacgtgggggacagcgatccccggccg
ctcttaaagcagatagccgacgccggtggctttatcagcgtggatatggggtactccaac
aaggtggagatctcctccgatcccgccagcattcctccgggcttcgatcccacgacccgc
gcctggtttatcaatgccagaaaagcagggcatccgatcgttaccgaaccgtatatggat
gcgaatacccataccctcgtggtaacctttgccgcgcccggcccacaggacacgccgatc
agcggcgtcgtcgagggcgatgtacacatggataaagtgattgccaacgtgcgatccatc
cgccccacggaaaacagctttggcatgctgctcaacgctgacggaaccattattgctcac
cccaatcagcagctaacgctgaagccgctggccaatatcgcgccaggcctgagcctgacc
cagctgttaacctccggcaaacccgtagaggcgaccgtttccggccgtgatgtactgctg
ctggcgatgccggtctctggaaccagctggtataccgtcgtggccatggataagacagag
gccacggccggaatgcgttcgctgctgctggcctcctgcattgcactgttggttctgatc
gttctcgccacgctggtgatcggcatcgttacgcgtcgagcgctgcgtccgctgttccat
atccgccaggcaatggaaaacatcggcgccggcaacaacgcggatctgaccaagcgattg
gatgtgcagggcaaagatgaggtctcgcagatcgcccgcgcatttaaccagttcgtggat
aagctggcccgggtgatggtctctattcacagcaccagtgaatcggttcgcattgccgcg
cgggaaatcgccgcgggcaacgaagatctctcttgtcgaaccgagtcagcggcggccagc
ctgcagcagacctcggcggcgttggagcagatctcttccaccgtcgcgcagtcggcgacc
tctgcccagcaggccaatgaggccgtcagctctgccgttcaggtagcgcagcgcggtggc
aagatgatctcgcaggtcattgaaaccatgtcttcgattgaggtcgcctccggtaaaatc
ggcgacatcaccggggttatcgatggcattgcattccaaaccaatatactggcgctcaac
gccgcggttgaagccgctcgcgcgggcgagcaggggcgtggatttgccgttgtcgccggc
gaggtcagaacgctggcccagcgcagcgcccaggcagccaaagagatcaaaaatctgatc
gactcaaccgtgaccagcgtcgcctccggttcacatcaggtacgccaaagcggtgaaacc
atgacggatattgtgaacagcgtcggcgccgtcagcgccatcatgggtgagatcaccaac
gcggcggaagagcaaaaccgcggcatcagtgagatcaacagcgcagtgatccagctggat
acgatggtgcagcagaacgccgccctggttgaggagtcaaccgcggcctccgccgcgctg
caagggcaggcgagtgagctggccgataccgtaggtcagttccgcatgtag

DBGET integrated database retrieval system