KEGG   Edwardsiella tarda EIB202: ETAE_1749Help
Entry
ETAE_1749         CDS       T01121                                 

Definition
(GenBank) antigenic protein Et 32
Organism
etr  Edwardsiella tarda EIB202
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1858256..1859206
Genome map
AA seq 316 aa AA seqDB search
MKLKTTLVASALLSATAFSVQAAQELTPQKAAELKPFEQIAISGRFNMLSEAADAVSRRA
DQLGAAYFYILDTNASNDGGNWRVVANVYKKDAETVDKSQRYRTFQGVKELPKQEAVALQ
PFDTVTVSGFFNSQPEVNDAVARAAKKKDAAAFYIVRQIDTNNGGNQTITAYVFKADAPK
RQVQSPDAIPANSDAGRAALAAGGAAAASVEIPGVASSSTLSNNVGQFWQTQSSTGHRYT
VTLPNGTKIEELNNATAAQMVPFDSITFTGRFNSMTDMSTEAAKRAAAKGAKYYHITRQW
QNQSGGNLTVSADLFK
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgaaaaccaccctcgttgcgtcggccctgctctctgccacggcattttctgtc
caggcggcccaagaactcacgccgcaaaaagccgcggagctgaagcctttcgaacaaatc
gccatcagcgggcgcttcaatatgctcagcgaggcggcggatgccgtttctcgccgggcc
gatcagctgggcgccgcctatttttatattctggataccaacgccagcaacgacggcggc
aactggcgcgtcgtggctaacgtctataagaaagatgcggaaaccgtcgacaagagccag
cgctaccgtaccttccagggggttaaagagctgccgaagcaagaggccgttgcgctgcag
cctttcgataccgtgaccgtcagcggcttctttaatagccagccagaggtaaacgacgcc
gtcgcccgcgccgcgaagaagaaagacgccgcggcgttttatatcgtgcgtcagatcgac
accaataacggcggcaaccagacgatcaccgcctacgtctttaaagccgatgcgccgaag
cgccaggtgcagagccctgatgcgatccccgccaactctgacgcaggccgcgcggcgctg
gccgccggcggtgccgcggccgctagcgtcgagatcccgggcgttgcctcctcctctacc
ctgagcaacaacgtcggccaattctggcaaacgcagtcctctaccggtcaccgttacact
gtaacattacccaacggtaccaaaatcgaagagctgaacaatgccaccgccgcccagatg
gttccctttgactccatcacctttaccggtcgctttaacagcatgaccgatatgtcaacg
gaagccgccaagcgtgcggcggcgaagggcgccaagtactaccacattacccgccagtgg
caaaatcagagcggcggcaacctgaccgtcagcgccgatctgtttaaataa

DBGET integrated database retrieval system