KEGG   Edwardsiella tarda EIB202: ETAE_1750Help
Entry
ETAE_1750         CDS       T01121                                 

Gene name
ydgI
Definition
(GenBank) arginine/ornithine antiporter
  KO
K03758  
arginine:ornithine antiporter / lysine permease
Organism
etr  Edwardsiella tarda EIB202
Brite
Transporters [BR:etr02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   ETAE_1750 (ydgI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1859448..1860839
Genome map
AA seq 463 aa AA seqDB search
MEKKLGLTALTALVLSSMLGAGVFSLPQNMADVASPAALLIGWVITGVGILFLALAMLLL
TRLRPDLDGGIFTYAKEGFGELVGFCSAWGYWLCAVIANVSYLVIVFAALSFFTDSPQQT
LFGDGNTWQAVIGESILLWVVHFMVLRGVKTAAGINLAATLAKLLPLGLFVVLAAIAFRL
DTFKIDFTGLKMGVPVWEQVKDTMLFTLWVFIGVEGAVVVSARARHKRDVGRATMLAVVS
ALVVYLLITLLSLGVVPRAELAEMRNPSMAGLMVKMIGPIGEIVIAGGLIISVCGAYLSW
TIMAAEVPFLASQHGAFPKIFGKQNAKEAPASSLWLTNGAVQVTLIIIWATGANYNNLLT
IASEMILVPYFLVGAFLYKVAREKGDRWITLAAIGACAYGLWLLYASGLTHLLMSVLLYA
PGLLVFMHARRSQCDRQRMSVLERSGICLLLMATLPAGWFMLH
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
ttggaaaaaaaactcggacttaccgccctgacggcgttggtattgagctccatgctcggc
gccggcgtattcagcctgccgcaaaatatggcggatgtggcaagccctgcggctctattg
atcggctgggtgattaccggcgtcggcattctgtttctggcgctggccatgctgctgttg
acccgcttacgccccgatctggacggcggtatctttacctacgccaaagaggggtttggc
gagctggtgggcttttgctcggcctggggatactggctgtgcgccgtgatcgccaacgtc
tcttatctggtcatcgtgtttgccgccctgagttttttcaccgattcgccgcagcagacg
ctgtttggcgatgggaacacctggcaggcggtgatcggcgagtccattctgctgtgggtc
gtgcactttatggtgctgcgcggggttaaaaccgcggcggggatcaacctggccgcgacg
ctggccaagctgctgccgctggggctgtttgtggtcctggccgccatcgccttccgcctg
gatacgtttaagatcgactttaccgggctgaagatgggcgtcccggtctgggagcaggtc
aaggacaccatgctgtttaccctgtgggtctttattggcgtggaaggcgccgtcgtggtc
tccgcccgcgcccgccataagcgggatgtgggtcgggcgacgatgctggccgtcgtctcc
gcgctggtggtctatctgttgataaccctgctctccctcggcgtggtgccgcgcgccgag
ctggcggaaatgcgcaacccctccatggcaggactgatggtgaagatgatcggcccgatt
ggcgaaatcgtgatcgccggcggactgattatctccgtctgcggcgcctacctgagctgg
accatcatggcggcagaggtgccgttcttggcctcgcagcacggggccttcccgaaaatc
ttcgggaaacagaatgccaaagaggcgccggcctcttcgctgtggctgaccaacggcgcg
gtgcaggtgacgctgatcatcatctgggcgaccggcgcaaactacaacaacctgttgacc
atcgcctccgagatgatcctggttccctacttcttggtcggcgccttcctgtataaggtc
gcgcgggaaaaaggcgatcgctggatcacgctggcggccatcggggcctgcgcctatggc
ctgtggctactttacgcctctgggctgacgcacctgctgatgtcggtgctgctgtatgcg
ccgggtctactggtctttatgcacgcgcgtcgttctcagtgcgatcgccagcggatgagc
gtgctggagcgcagcgggatctgcctgctcctgatggcaaccctgcccgccggctggttt
atgctgcactga

DBGET integrated database retrieval system