KEGG   Edwardsiella tarda EIB202: ETAE_1752Help
Entry
ETAE_1752         CDS       T01121                                 

Definition
(GenBank) hypothetical protein
Organism
etr  Edwardsiella tarda EIB202
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1861771..1861920
Genome map
AA seq 49 aa AA seqDB search
MYYSDRENFFKEITTYSPRLVYFYLQNEKYYSYPLCTTFSILYVALNIL
NT seq 150 nt NT seq  +upstreamnt  +downstreamnt
atgtattacagcgatagggaaaacttttttaaagaaataacgacatattctccacgcctt
gtttatttttatttacaaaatgagaaatattatagttatcccctttgcacaaccttttct
atcctgtatgtagcgctaaacattttgtga

DBGET integrated database retrieval system