KEGG   Edwardsiella tarda EIB202: ETAE_1754Help
Entry
ETAE_1754         CDS       T01121                                 

Gene name
rstA
Definition
(GenBank) DNA-binding response regulator in two-component regulatory system with RstB
  KO
K07661  
two-component system, OmpR family, response regulator RstA
Organism
etr  Edwardsiella tarda EIB202
Pathway
Two-component system
Module
RstB-RstA two-component regulatory system
Brite
KEGG Orthology (KO) [BR:etr00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    ETAE_1754 (rstA)
Two-component system [BR:etr02022]
 OmpR family
  RstB-RstA [MD:M00446]
   ETAE_1754 (rstA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1862896..1863618
Genome map
AA seq 240 aa AA seqDB search
MSRIVFVEDDPDVGQLIAAYLGKHDIDVTLEPRGDTAFDTIIRLKPDLVMLDIMLPGKDG
MSLCRDLRPAYAGPIVLLTSLDSDMNHILSLEMGASDYILKTTPPAVLLARLRLHLRQHA
TPLPESTRAAPASSARLNPLQLGQLCIDPVNREVRLGSAEVHLSTSDFDLLWELATHAGT
IMDRDALLQNLRGVSYDGLDRSIDVAISRLRRKLNDTGPEPVRIKTVRNKGYLFAPNAWE
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgagcagaattgtatttgttgaggatgatcccgacgtaggccagctgattgccgcctat
ctggggaaacatgacattgatgtcacgctggagccgcgcggcgataccgcctttgacacc
atcattcggctaaagccggatctggtgatgctggatatcatgctaccggggaaggatggc
atgagcctatgccgggatttgcggccggcctacgcggggcccatcgtgctgctgacctcg
ctcgacagcgatatgaaccatatcctgtcgctggagatgggcgccagtgactatattctg
aaaacgacgccgccggcggtgctgctggcgcgcctgcgtctgcacctgcgccagcatgcg
acgccgctgccggaaagtacgcgcgccgcgccggcgtcgtcggcccgactcaatccgctg
cagctcggtcagctctgtatcgatccggtcaaccgcgaggtgcgcctcggcagcgcggag
gtacatctctccacctccgattttgacctgctgtgggagctggcaacccacgccggcacc
attatggatcgcgatgccctgctgcagaatctgcgcggcgtcagctatgacggtctggat
cgcagcatcgatgtggccatctcccgtctgcgccgcaagctgaacgataccgggccggag
cccgtgcgcatcaagaccgtacgcaataagggatacctgtttgcgcctaacgcctgggaa
tag

DBGET integrated database retrieval system