KEGG   Edwardsiella tarda EIB202: ETAE_1757Help
Entry
ETAE_1757         CDS       T01121                                 

Definition
(GenBank) hypothetical protein
  KO
K13450  
phosphothreonine lyase [EC:4.2.3.-]
Organism
etr  Edwardsiella tarda EIB202
Brite
Enzymes [BR:etr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.-  
     ETAE_1757
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1866757..1867407)
Genome map
AA seq 216 aa AA seqDB search
MPPMNESLKSNFDTLHRQMRQMPLSHFTVEPNAPDYSGIRQSGFFALSQGFRLSNASDDF
FIHARREAPQYRGEFIGDKFHISVQEQQVAQAFQALSGLLFSEDSPIDKWKVTDMARVDQ
QSRVGEGAQFTLYVKPDRGDSQYSATALHKTRQFIASLESRLSEQGIIPGRVPESDVHPD
SWRYISYRNELRSERGGGEMQSQALREEPFYRLMTE
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgcccccaatgaatgagagcctaaaaagcaatttcgacacgctgcaccgtcaaatgcgc
cagatgccgctttcccacttcaccgtagagccgaatgcgccggactactcagggatacgc
cagagtggcttctttgccctgagtcagggatttcgcctgtcgaacgcgagtgatgatttc
ttcattcacgcccgtcgcgaagcgccgcagtacaggggcgaatttatcggtgacaagttc
cacatcagcgtgcaagagcaacaggtagcgcaggcctttcaagcgctatctggactgctg
ttttcagaggacagccccatcgataagtggaaggtgaccgatatggcgcgggtcgatcag
caatcccgcgttggcgaaggggcgcagtttacgctgtatgtcaagccggatcggggcgat
tcgcagtacagtgcgacggcgcttcacaagacgcggcaatttatagccagtctggagtcg
aggctatcggagcaggggattatccccgggcgcgtccccgagtcggacgtccatcccgac
agttggcggtatatcagttatcgtaacgagctgcgcagcgagcgcggcggtggcgagatg
caaagccaagcgttacgagaagagcctttttaccgtttgatgacagagtag

DBGET integrated database retrieval system