KEGG   Edwardsiella tarda EIB202: ETAE_1777Help
Entry
ETAE_1777         CDS       T01121                                 

Gene name
qacE
Definition
(GenBank) membrane transporter
  KO
K03297  
small multidrug resistance pump
Organism
etr  Edwardsiella tarda EIB202
Brite
Transporters [BR:etr02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   ETAE_1777 (qacE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1886113..1886445)
Genome map
AA seq 110 aa AA seqDB search
MNGYLYLAMAIGAEVIATTALKATQGFSRLGPSLVVVVGYAIAFWGLSQVVKSIPLGVAY
AIWSGMGIVLVSLAAYWLYQQTLDWAALLGMAMIVGGVLVINLFSHTSAH
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atgaacggatatctgtatctggcgatggcgatcggcgccgaggtgatcgccacgaccgcc
ctgaaagccacccaggggtttagccgactcggcccgagtctggtggtggttgttggatat
gccattgctttctggggactttctcaggtagtgaagagcatcccgctgggcgtcgcctat
gcgatttggtccggtatggggatcgtgctggtctcgctggccgcctactggctgtaccag
cagacgctcgactgggcggcgctgctggggatggcgatgatcgtcgggggcgtgctggtg
attaatttattctcccacacgtcggcacattaa

DBGET integrated database retrieval system