KEGG   Edwardsiella tarda EIB202: ETAE_1778Help
Entry
ETAE_1778         CDS       T01121                                 

Gene name
nifJ
Definition
(GenBank) pyruvate flavodoxin/ferredoxin oxidoreductase domain protein
  KO
K03737  
pyruvate-ferredoxin/flavodoxin oxidoreductase [EC:1.2.7.1 1.2.7.-]
Organism
etr  Edwardsiella tarda EIB202
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:etr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ETAE_1778 (nifJ)
   00020 Citrate cycle (TCA cycle)
    ETAE_1778 (nifJ)
   00620 Pyruvate metabolism
    ETAE_1778 (nifJ)
   00650 Butanoate metabolism
    ETAE_1778 (nifJ)
Enzymes [BR:etr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     ETAE_1778 (nifJ)
    1.2.7.-  
     ETAE_1778 (nifJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1886643..1890173
Genome map
AA seq 1176 aa AA seqDB search
MITIDGNSAVASVAYRASEVIAIYPITPSSGMAEQASAWSADGRPNVWGDIPRVVEMQSE
GGAIAAVHGALQTGALATSFTSSQGLLLMIPTLYKLAGELTPFVLHVAARTVATHALSIF
GDHSDVMAVRQTGCAMLCAASVQEAQDFALIAHIASLNSRLPFIHFFDGFRTSHEINKIV
PLADDTLQTLLPAQAIAAHRAHALTPEHPVIRGTSANPDTYFQAREASNPWYDAAYDHVA
DAMQAFADQCGRRYQPFEYDGDPEATRVIVVMGSACGTCAEVCDMLRARGEKVGVLKVRL
YRPFSARHLLAALPLSAQRIAVLDRTKEPGALGEPLYLDVIAALAQAVSSGERAALPLTI
GGRYGLSSKEFGPDCALAVFEALETPRPRPRFTVGINDDVTHLSLPRRTDVHPVSNRLEA
LFYGLGSDGTVSAAKNNIKIIGNSTPLHAQGYFVYDSKKAGGLTVSHLRVRETPIHSAYL
VEQADFIGCHQWQFIERYQMVERLRLGGIFLLNTPYAADEAWARLPQEVQALLNARQAKF
YVINAARIARECRLGARINTVMQMAFLHLSDLIPNGGALPLLQDAIARSYANKGQEIVER
NWQALGAVEGALHAVPLRPVDAESPRRPPIVADQAPDFVKTVTAAMLAGLGDSLPVSAFP
PDGTWPVGTTRWEKRNIAEAIPIWQPALCTQCNHCVAACPHAAIRAKVVAPAALEHAPAT
LESLEVRARDLRGERYVLQVAPEDCTGCNLCVTVCPAADRQDPSVKAINMQPRLAHLARE
KAHYDAFLALPEIDRRRLERIDIRTSQLISPLFEYSGACSGCGETPYIKLLTQLFGDRML
IANATGCSSIYGGNLPTSPYTTDAQGRGPAWANSLFEDNAEFGLGFRLSAQQHRQRALRL
LHALAGQLPEALVAALQQEETPTETRRQQIAALRAALATLDDPQAQALAQTADALVEQSI
WLIGGDGWAYDIGFGGLDHVLSLSENVNVLVLDTQCYSNTGGQQSKATPLAAVTKFGEHG
KRKARKDLGVSMMMYGHVYVAQISLGAQLNQTVKALQEAESYPGPSLVIAYSPCEEHGYD
LADSHEQMKRLTANGFWPLYRFDPRRGAEGQNALALDSRPPSGDLAQTLLAEQRFRRLNS
LAPQEAQTLYREAEENLRQRFALLSLLAGKTPPATE
NT seq 3531 nt NT seq  +upstreamnt  +downstreamnt
atgatcaccattgacggtaacagcgcagtggcgtccgtggcctatcgagccagcgaagtc
attgccatctatccgattacccccagctcaggcatggccgagcaggcctccgcctggtcc
gccgacggacgccccaacgtctggggcgatattccacgcgtcgtcgagatgcagtctgag
ggcggcgccatcgccgccgtacacggcgcgctgcagaccggggcactggccaccagcttt
acctcatcccaggggctgctgctgatgatccccaccctgtataagctggctggcgaatta
acccccttcgttctgcacgtcgccgcgcgcaccgtcgccacccatgcgctctccattttc
ggcgaccactccgacgtcatggcggtacgccagaccggctgcgctatgctgtgcgccgcc
agcgtgcaggaggcccaggatttcgccctgatagcccatatcgcctccctcaacagccgt
ctgccgtttatccacttcttcgacggtttccgcacctctcacgaaatcaacaaaatcgtg
ccgctggccgacgatacgctgcagacgctgctgccggcgcaggccatcgccgcccaccgc
gcccatgcgctgaccccggagcacccggtgatccgcggaacctccgccaacccggacacc
tattttcaggcacgagaggccagcaacccgtggtacgacgccgcctatgaccacgtggcc
gacgccatgcaggccttcgccgaccagtgcgggcgccgctaccagccgtttgaatacgat
ggcgatcccgaggccacccgggtcatcgtcgtgatgggctccgcctgcggcacctgcgcc
gaggtgtgcgatatgctgcgcgcgcgcggggagaaggtgggcgtactgaaggtgcggctg
taccgtcccttctccgcccgtcacctgctcgccgcgctgcccctctccgcgcagcgcatc
gcggtgctcgaccgcaccaaagagccgggggcgctgggcgagccgctgtacctggacgtc
atcgccgcgctggcgcaggcggttagcagcggcgaacgcgccgcgctgccgctcaccatc
ggcgggcgctacggcctttccagcaaggagtttggccccgactgcgccctggcggtattt
gaggcgctggagaccccgcggcctcgaccgcgttttaccgtgggcatcaacgacgacgtg
acccacctctccctgccgcgccggacggatgtccacccggtgagcaaccggctggaggcg
ctgttctatgggctgggcagcgacggcaccgtctcggcggcgaagaacaacatcaagatt
atcggtaacagcacgccgctgcatgcccagggctactttgtctatgactccaaaaaggcc
ggcggcctgaccgtgtcacacctgcgagtacgggaaacgcccattcactccgcctacctg
gtggagcaggccgactttatcggctgccaccagtggcagttcattgaacgctatcagatg
gttgagcgtctgcgcctcggggggatcttcctactaaataccccctatgccgcagacgag
gcgtgggcgcggctgccccaggaggtgcaggcgctgctcaacgcacggcaggcgaagttc
tacgttatcaacgccgcccgtatcgcccgcgagtgtcggctcggcgcccgcatcaacacc
gtcatgcagatggcctttctgcacctcagcgacctgatccccaacggcggcgccctgccg
ctgctgcaggatgccatcgcccgcagctatgccaataaaggacaggagatcgtcgaacgc
aactggcaggcgctgggggcggtcgagggcgcgctgcacgccgttcccctgcgcccggtc
gatgccgagagcccgcgccggccgccgatcgtcgccgaccaggcgccggactttgtcaaa
accgttaccgccgccatgctggccgggctgggcgacagcctgccggtctccgccttcccg
ccggacggcacctggcccgtcggcactacccgctgggagaagcgtaatatcgccgaggcc
atccccatctggcagcccgccctctgcacccagtgtaaccactgcgtcgccgcctgcccc
cacgcggcgatccgcgccaaggtggtcgcgccggcggcgctggagcacgcgccagccacg
ctggagagcctggaggtccgcgcccgcgatctgcgcggcgagcgctatgtgctgcaggtg
gcaccggaagactgcaccggctgcaacctgtgcgtgacggtctgcccggcggcggatcgt
caggaccccagcgtcaaggccatcaatatgcaaccacgtctggcgcacctggcgcgggaa
aaggcgcattacgacgcgtttctggccctgccggagatcgaccgccgtcgcctggagcgc
atcgatatacgcacctcgcagctgatttcgccgctgtttgaatactccggcgcctgctcc
ggctgcggtgaaaccccctatatcaagctgctgacccagctgttcggcgatcgtatgctg
atcgcgaacgccaccggctgctcctccatctatggcggcaacctccccaccagcccctat
accaccgatgcacagggacgggggccggcctgggccaactcgctgtttgaggataacgcc
gagtttggcctcggcttccgcctgagcgcccagcagcaccgccagcgggcgctgcgcctg
ctccatgcgctggccggacagctgccagaggcgctggtcgcggcgctgcagcaggaggag
acgcccaccgagacgcggcgtcagcagatagcggcgctgcgcgcggccctggcgacgctc
gacgatccgcaggcccaggcgctggcgcagacggccgatgccctggtagagcaatccatc
tggctgatcggcggcgatggctgggcctacgatatcggcttcggcgggctggatcacgtg
ctgagcctgagcgaaaacgtcaacgtcctggtcctggatacccagtgctactccaatacc
ggcggacagcagtccaaggcgacgccgctggcagcggtcaccaagtttggcgaacacggt
aagcgcaaagcgcgtaaggatctcggcgtcagcatgatgatgtatggccacgtctacgtc
gcccaaatctcgctgggcgctcagctgaaccagaccgtcaaggcgctgcaggaggccgaa
tcctatccgggcccctcgctggtgatcgcctacagcccctgtgaggagcacggctacgat
ctggccgacagccatgagcagatgaagcgcctgacggccaatggattctggccgctgtac
cgctttgatccgcgccgcggcgccgaggggcagaacgccctggcgctggactcccggccg
cccagcggcgatctggcgcaaacgctgctggccgaacagcggttccgtcggctgaacagc
ctggcgccgcaggaggcgcagacgctataccgcgaggcagaggagaacctgcgtcagcgt
ttcgccctgctcagcctgctggcggggaaaacgccccctgccaccgagtaa

DBGET integrated database retrieval system