KEGG   Edwardsiella tarda EIB202: ETAE_1822Help
Entry
ETAE_1822         CDS       T01121                                 

Gene name
pfkB
Definition
6-phosphofructokinase
Orthology
K16370  
6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
etr  Edwardsiella tarda EIB202
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:etr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ETAE_1822 (pfkB)
   01230 Biosynthesis of amino acids
    ETAE_1822 (pfkB)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ETAE_1822 (pfkB)
   00030 Pentose phosphate pathway
    ETAE_1822 (pfkB)
   00051 Fructose and mannose metabolism
    ETAE_1822 (pfkB)
   00052 Galactose metabolism
    ETAE_1822 (pfkB)
  Energy metabolism
   00680 Methane metabolism
    ETAE_1822 (pfkB)
Enzymes [BR:etr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     ETAE_1822 (pfkB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1933379..1934332)
Genome map
AA seq 317 aa AA seqDB search
MNPIYTLTLSPSLDCSTSTAKIYPEGKLRCSQAIYQPGGGGINVARAIQRMGGGAVAIYP
AGGSTGAHLTTLLLAEGVAVDTIEAQAWTRQNMHVSATATGEQFRFVMPGAALTPREFDL
LAQRLDQIPTDALLVVSGSLPENITPSRFSALLQHIRQRGIRCVVDTSGDALMAAVNQGG
LTLIKPNQKELATLSGRDMTQPASVLQAAHALVLQGAAQYVVVSLGAQGAIAVDRQAWIQ
VTPPPIKALTTVGAGDSMVAAMTLQLAQGGALSALAIGGVAAGTAATLRHGTELCQASDV
AEIVAYIEAHHPQPHSF
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgaaccctatctatacccttacgctgtctccctcgctggactgttcgaccagcacggcc
aaaatatatcctgagggtaagctacgctgcagtcaggccatctaccaaccgggcggcggt
gggatcaacgtggcccgggccattcagcgcatgggcggcggcgccgtggccatctatccg
gcgggaggatcgaccggcgcgcacttgaccacgctgctgctggcggagggggtggcggtc
gatacgatcgaggcgcaggcctggacgcgtcagaatatgcatgtcagtgcgacggcgacc
ggcgagcagttccgttttgtgatgcccggcgcggcgctgacgccgcgggagttcgatctc
ctggcgcaacgattggatcagatcccgaccgatgccctcttggtggtgagtgggagtctg
ccggagaacattacgccgtcgcggttttccgcgctgctgcagcacattcgtcagcgcggt
attcgctgcgtcgtcgatacctcgggcgatgccctgatggcggcggtgaatcaaggggga
ctgacgctgattaagcccaatcaaaaggagctggcgacgttgagcggtcgagatatgacc
cagccggcctcggttttgcaggcggcccacgcgctggtattacagggcgccgcacagtat
gtggtggtttcgctgggggcgcagggggcgattgccgtcgatcgccaggcctggattcag
gtgacgccgccgccgattaaggcactgacgacggtgggggccggcgacagtatggtcgcc
gcgatgacgctgcagctggctcagggaggagcgctgagcgcgctggcgatcggcggcgtt
gcggccggaaccgcggcgacgctgcgccatggcaccgaactctgccaggcgagcgatgtc
gccgagatcgtggcttatatcgaggcccaccacccacagccgcattcattttaa

DBGET integrated database retrieval system