KEGG   Edwardsiella tarda EIB202: ETAE_1978Help
Entry
ETAE_1978         CDS       T01121                                 

Definition
sugar kinase, ribokinase family
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
etr  Edwardsiella tarda EIB202
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:etr00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    ETAE_1978
Enzymes [BR:etr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     ETAE_1978
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2089554..2090474)
Genome map
AA seq 306 aa AA seqDB search
MDIAVIGSNMVDLITYTNQMPKEGETLEAPAFKIGCGGKGANQAVAAAKLNSNVMMLTKV
GDDIFADNTIRNLESWGINTTYVEKVPCTSSGVAPIFVNANSSNSILIIKGANKFLSPED
IDRAAEDLKKCQLIVLQLEVQLETVYHAIEFGKKHGIKVLLNPAPALRELDMTYACKCDF
FVPNETELEILTGLPVDSYEHTRTAARTLIEKGLNNIIVTMGEKGALWMTRDQEVHVPAF
KVCAVDTSGAGDAFIGCFAHYYVQDGDVEAAMKKASLFAAFSVTGKGTQSSYPSIEQFNE
FLALNA
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggatattgcagttatcggttctaatatggttgatctcattacctataccaatcagatg
cccaaggagggcgagacgctggaggcaccggcatttaaaattggctgcggcggcaagggc
gccaatcaggcggtggcggcggcaaagctcaattcaaacgtgatgatgttgactaaggtc
ggcgatgatatttttgcggacaatacgatccgtaacctggagtcctgggggatcaatacc
acctacgtggaaaaggtcccctgcaccagcagcggcgtcgcgccgatttttgttaacgcc
aactccagtaacagcattctgattatcaagggcgccaataagtttctctctccggaggat
attgatcgggcggcggaggatttaaagaaatgccagctgatcgtattacagctggaggtt
cagctggaaaccgtctatcacgcgattgagtttggcaaaaagcatgggattaaggtgctg
ctgaatccggcgccggcgctgcgtgagctggatatgacctatgcctgtaaatgtgatttc
tttgtccccaatgaaaccgagctggagatcttgaccgggctgccggttgactcctatgag
catacgcggacggcggccagaacgctgatcgagaagggactgaataatatcattgtcacc
atgggagagaagggcgcgctgtggatgacgcgcgatcaggaggtgcacgtgcctgcattc
aaggtgtgtgcggtggacaccagcggcgccggcgatgcctttattggctgctttgcccac
tactatgtgcaggacggcgatgtggaggcggcgatgaagaaggcatcactgttcgccgca
ttcagcgtaacggggaaaggaacgcaatcgtcctatcccagtatcgaacagttcaatgag
tttttggcattgaacgcataa

DBGET integrated database retrieval system