KEGG   Edwardsiella tarda EIB202: ETAE_2100Help
Entry
ETAE_2100         CDS       T01121                                 

Gene name
fabD
Definition
malonyl CoA-acyl carrier protein transacylase
Orthology
K00645  
[acyl-carrier-protein] S-malonyltransferase [EC:2.3.1.39]
Organism
etr  Edwardsiella tarda EIB202
Pathway
Fatty acid biosynthesis
Metabolic pathways
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:etr00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    ETAE_2100 (fabD)
  Lipid metabolism
   00061 Fatty acid biosynthesis
    ETAE_2100 (fabD)
Enzymes [BR:etr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.39  [acyl-carrier-protein] S-malonyltransferase
     ETAE_2100 (fabD)
Lipid biosynthesis proteins [BR:etr01004]
 Fatty acid synthase
  Component type
   ETAE_2100 (fabD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2214968..2215897)
Genome map
AA seq 309 aa AA seqDB search
MSTFAMVFPGQGSQTVGMLADLAAQYPVVEQTFAEASEALGYDLWSLVQQGPAEELNKTW
QTQPALLTASVAIYRVWQQNHGKQPAMMAGHSLGEYSALVCAGVLDFTQAVRLVELRGKL
MQQAVPAGTGAMYAIIGLDNDAIAAACAEAAQGQVVAPVNFNSPGQVVIAGEKEAVERAG
AACKAAGAKRALPLPVSVPSHCALMKPAADQLAEALKAIDFHAPSCPVINNVDVTAASDA
DAIRDALVRQLYSPVRWTETVQLMAAEGVDHLLEMGPGKVLTGLTKRIVDTMTAAAVNDC
ASLTAALEQ
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgtctacatttgcaatggtattccccgggcaggggtcacagaccgtgggtatgctggcc
gatttagccgcacagtacccggtggtcgagcagaccttcgccgaggcctccgaggcgctg
ggttatgatttgtggagcctggtgcagcaagggccggccgaagagctgaacaagacctgg
cagacccagccggcgctgctgacggcctccgtcgcaatttaccgcgtctggcagcagaac
catggcaaacagccggcgatgatggctgggcacagcctgggtgaatactctgcgctggtc
tgcgccggcgtcctcgactttacgcaggcggtacgcctggtcgagctgcgcggcaagctg
atgcagcaggcggtgccggcaggcaccggtgcgatgtatgccatcatcggtctggacaac
gacgccatcgccgccgcctgcgccgaggcggcgcaggggcaggtggtcgcgccggtcaac
ttcaactcgccggggcaggtggtgatcgccggtgaaaaagaggccgtcgagcgcgccggc
gccgcctgtaaggccgccggtgccaagcgtgcgctgccgctgccggtcagcgtaccgtcg
cactgtgcgctgatgaagccggccgcggaccagctggccgaggcgctgaaagcgatcgac
ttccatgcgccgtcctgtccggtgatcaataacgtcgatgtgacggcggcgagcgacgct
gatgcgatacgcgatgcgctggtgcgccagctctacagcccggttcgctggacggagacc
gtgcagctgatggccgccgaaggcgttgaccatctgctggagatgggcccgggcaaagtg
ttgaccggcctgaccaagcgtatcgtcgataccatgaccgctgcggcggtgaatgactgc
gcatccctgaccgccgctctcgaacagtaa

DBGET integrated database retrieval system