KEGG   Edwardsiella tarda EIB202: ETAE_2118Help
Entry
ETAE_2118         CDS       T01121                                 

Definition
D-beta-hydroxybutyrate dehydrogenase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
etr  Edwardsiella tarda EIB202
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:etr00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:etr00072]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2234545..2235258
Genome map
AA seq 237 aa AA seqDB search
MGIAKTLAQQGAQVILNGFGDVAHATGQIAACGLPPGYHSADLSHPDHIAAMMDYATTQF
GGVDILVNNAGIQHVASVEHFPEEQWDAILAVNLSSVFHTSRLALPALREKGWGRIINIA
SVHGLVASTQKAAYVAAKHGVVGLTKVIALETARSPVTCNAICPGWVLTPLVQQQIAARA
ADGDTQQARDALLAEKQPSLDFVTPQQLGALALFLCSPAADQVRGAAWNVDGGWLAQ
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
ttgggtattgcgaaaacgctggcgcagcagggcgcgcaggtcattctgaatggctttggc
gacgttgcgcacgccaccgggcaaatagccgcgtgcggcctccccccgggctaccactcg
gctgacctgagccatcccgaccatatcgccgccatgatggattacgccactacacagttc
ggcggcgtggacattctggtcaataacgcgggaatacagcatgtcgccagcgtagagcat
ttcccggaggagcaatgggatgcaatcctcgcagtcaacctctcttctgtatttcatacc
agccgtctggccttgcctgccctacgggagaagggctggggccgcataatcaatatcgcc
tccgtgcacggcttggtcgcctccacgcaaaaggcggcatacgtggcggccaagcatggc
gtggtggggctgacgaaggtgattgcgctggaaaccgcgcgcagcccggtcacctgtaat
gccatctgccccggttgggtactcacgcccctggtgcaacagcagatagcggcgcgggct
gccgacggtgatacccagcaggctcgggatgcgctactggcagagaagcagccgtcgctg
gattttgtgacgccgcagcaattaggcgcgctggcgctatttttatgcagcccggcggcc
gatcaggtgcgcggtgcggcgtggaatgtggacgggggctggctggctcaatag

DBGET integrated database retrieval system