KEGG   Edwardsiella tarda EIB202: ETAE_2380Help
Entry
ETAE_2380         CDS       T01121                                 

Gene name
nuoG
Definition
NADH dehydrogenase/NADH:ubiquinone oxidoreductase 75 kD subunit (chain G)
Orthology
K00336  
NADH-quinone oxidoreductase subunit G [EC:1.6.5.3]
Organism
etr  Edwardsiella tarda EIB202
Pathway
Oxidative phosphorylation
Metabolic pathways
Module
NADH:quinone oxidoreductase, prokaryotes
Brite
KEGG Orthology (KO) [BR:etr00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    ETAE_2380 (nuoG)
Enzymes [BR:etr01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.3  NADH:ubiquinone reductase (H+-translocating)
     ETAE_2380 (nuoG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2505983..2508718)
Genome map
AA seq 911 aa AA seqDB search
MATIHVDGKEYDVDGAENLLQACLSLGLDIPYFCWHPALGSVGACRQCAVKQYQNAEDTR
GRLVMSCMTPATDGTYISIDDEEAKRFRESVVEFLMTNHPHDCPVCEEGGNCHLQDMTVM
TGHRLRRYRFTKRTHENQDLGPFISHEMNRCIACYRCVRYYKDYAGGTDFGVYGAHDNVY
FGRPQSGTLESEFSGNLVEICPTGVFTDKTHSERYNRKWDMQFSPSICQQCSVGCNTSPG
ERYGELRRIENRFNGTVNHYFLCDRGRFGYGYVNLKDRPRRPQQRRGTDWIDLNAEQALQ
GGADILRRASKVIGIGSPRASVESNFALRELVGAENFYSGIDVGELKRLNLMLSVLRDGG
IYTPSLREMEQYDAVLILGEDVTQTAARIALALRQAVKGKAQAMAAAQRVADWQIAAVQN
IGQHAKYPLFITSIDETRLDDIAALNYCAPVADQARLGFAVAHALDDRAPAVEGLSDAVR
RQVDIIAQALAGARKPLIVTGSGAGYTPMIEAAANVARALKQRELEVGITFVPAEANSMG
LAMMDASSLDNALVQLEQGYADTAIVLENDLYRHAPSARVDAALAKANGLIVIDHQRTAI
MDRADLVLSAASFAESDGTLVNQEGRAQRFFQVFDPAFYDDPKKKAPTIMLEGWRWLHAL
RVSAGQQAPDWTQLDQVIADCVQTCPQFAGMVDAAPNAAFRVRGQKLAREPLRYSGRTSM
LANISVHEPRQPQDKDTAFAFSMEGYSAPQAERQEFAFAWAPGWNSPQAWNKFQDEVGSH
LRFGDPGVRLIAAGDGALPYFTQIPAPYQVHGWVIAPYYHLFGSDELTQRAPVIQRRMPQ
ACVRVCPEDAARMGASEGATIELSCAGEVLRLPLQISRHLQPGQVGLPLGMPGVAPVLNG
VKVDYMREAAV
NT seq 2736 nt NT seq  +upstreamnt  +downstreamnt
atggcaacaatacatgtagacggcaaagagtatgacgtcgacggggcggagaacctgcta
caggcctgtctctccctggggctcgacataccctacttttgctggcatccggcgctgggc
agcgtcggcgcctgccgccagtgtgcggttaagcagtaccagaacgcggaggatacccgt
gggcgactggtgatgtcctgtatgacgccggccaccgatggcacctatatctccatcgat
gacgaggaggccaagcgcttccgcgagagcgtggtggagtttttgatgaccaaccacccg
cacgactgtccggtgtgcgaggagggcggcaactgccacctgcaggatatgaccgtgatg
accggccaccgcctgcgccgctaccgctttaccaagcgcacccatgaaaatcaggatctg
gggccgtttatctcccacgagatgaaccgctgcatcgcctgctaccgctgcgtgcgctac
tacaaggattacgccggcggcaccgatttcggtgtctacggcgcccacgataacgtctac
ttcggacgcccgcagagcggcacgctggagagcgagttttccggcaacctggtggagatc
tgcccgaccggggtgttcaccgacaagacccactccgagcgctacaaccgcaagtgggat
atgcagttttcccccagcatctgccagcagtgcagcgtcggctgtaacaccagtcccggc
gagcgctacggcgagctgcgccgcatcgagaaccgcttcaacggcaccgtgaaccactac
ttcctgtgcgatcgcggccgcttcggctacggctatgtcaaccttaaggatcgtccgcgc
cggccgcagcagcgccgcgggacggactggatcgatctcaacgccgagcaggcgctgcag
ggcggggccgatattctgcgccgcgccagcaaggtgatcggcatcggttcgccgcgcgcc
agcgtcgagagcaacttcgccctgcgcgagctggtgggggcggagaacttctacagcggc
atcgacgtgggcgagctgaagcgcctgaatctgatgctgtcggtgctgcgcgatggcggc
atctacacgccgtccctgcgcgagatggagcagtacgatgcggtgctgatcctcggtgag
gatgtgactcagaccgcggcgcgcatcgcgctggccctgcgtcaggcggtgaagggcaag
gcgcaggccatggccgccgctcagcgggtggccgactggcagatcgccgcggtgcagaac
atcggtcagcacgccaaatacccgctgtttatcactagtattgatgaaacccgtctggat
gatatcgccgcattgaattactgcgcgccggtggctgaccaggcgcgcttaggctttgcc
gtggcgcacgcgctggatgaccgcgcgccggcggtggaagggctgtcggatgcggtgcgt
cgtcaggttgatatcatcgctcaggcgctggccggtgcgcgcaaacccctgatcgtgacg
ggcagcggggcgggctataccccgatgatcgaggcggcggccaacgtggcgcgtgcgctg
aagcagcgtgagctggaggtcggtatcaccttcgtgccggcagaggccaacagcatgggg
ctggcgatgatggatgcctcctcgctggataatgcgctggtgcagctggagcagggctat
gcggataccgcgattgtgctggagaacgatctgtaccgtcatgcgccgtcggcgcgcgtc
gatgcggcgctggccaaggccaacggtctgatcgtcatcgaccatcagcgcacggcgatt
atggaccgcgccgatctggtgctctccgccgctagctttgccgaaagcgacggcaccctg
gttaaccaggaaggccgcgcccagcgcttcttccaggtgttcgatccggcgttttacgac
gatccgaagaagaaggccccgaccattatgctggagggctggcgctggctgcatgcgctg
cgcgtcagcgccgggcagcaggcgccggactggactcagctcgatcaggtgatcgccgac
tgcgtgcagacctgtccgcagttcgccggcatggtcgacgcggcgccaaacgccgccttc
cgggtgcgtgggcagaagctggcccgtgagccgctgcgctacagcgggcgcacctcgatg
ctggccaacatcagcgtccatgagccgcgccagccgcaggataaggacaccgcctttgcc
ttctcgatggagggctacagcgcgccgcaggccgagcgtcaggagtttgcctttgcctgg
gcgccgggctggaactccccgcaggcctggaacaagttccaggatgaggtcggtagccat
ctgcgcttcggcgatccgggcgtgcgcctgatcgcggccggtgacggcgcattaccctat
ttcactcagatcccggcgccgtatcaggtgcacggctgggtgatcgccccttactaccat
ctgtttggcagcgacgagctgacccagcgtgcgccggtgattcagcgtcgcatgccgcag
gcctgcgtgcgggtctgtccggaggatgccgcgcggatgggcgcgtcggagggggcgacg
atcgaactgagctgcgccggcgaggtgctgcgtctgccgctgcagattagtcgccacctg
cagccgggccaggtcggtctgccgctgggcatgccgggggtcgcgccggtgctgaacggc
gttaaagtggattacatgcgggaggctgcggtatga

DBGET integrated database retrieval system