KEGG   Edwardsiella tarda EIB202: ETAE_2569Help
Entry
ETAE_2569         CDS       T01121                                 

Gene name
gpmA
Definition
(RefSeq) phosphoglyceromutase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
etr  Edwardsiella tarda EIB202
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:etr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ETAE_2569 (gpmA)
   01230 Biosynthesis of amino acids
    ETAE_2569 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ETAE_2569 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    ETAE_2569 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ETAE_2569 (gpmA)
Enzymes [BR:etr01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     ETAE_2569 (gpmA)
Exosome [BR:etr04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   ETAE_2569 (gpmA)
  Exosomal proteins of melanoma cells
   ETAE_2569 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2696901..2697653
Genome map
AA seq 250 aa AA seqDB search
MAVTKLVLVRHGESEWNRENRFTGWTDVELSEKGRQEARAAGRLLKAQGFSFDVAYTSVL
KRAIHTLWHVLDEIDQPWLAVEKSWKLNERHYGALQGLNKAETAQQYGDEQVKLWRRAFA
ITPPALTPDDPRYPGHDPRYAALSADELPLTESLATTIERVIPYWQQQIAPRIAAGERII
IAAHGNSLRALVKHLDHLSESEIIELNIPTGVPLVYEFDADMQPLRHYYLGDADEIAARQ
NAVANQGKAG
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggctgtcaccaaactggttctggtccgtcacggcgaaagcgagtggaaccgggaaaac
cgcttcaccggctggaccgacgttgaactgtcagagaaagggcgccaagaggcgcgggcg
gcgggtcgccttctgaaggcgcagggattttcctttgacgtcgcctacacctccgtgctc
aagcgcgccattcacaccctgtggcacgtactggatgagatcgatcagccgtggcttgcg
gttgaaaaatcatggaagctcaatgagcgccactacggcgccctgcaggggctgaacaag
gcggagaccgcgcagcagtacggcgacgaacaggtcaagctgtggcgccgcgcctttgcc
atcaccccaccggctctgacgccggacgatccccgctatcccggccacgatccgcgctat
gcggccctaagcgccgacgagctcccgctgacggagagcctggccaccaccattgagcgg
gtgatcccctattggcagcagcagatcgcgccgcgcatcgccgccggcgagcggatcatc
atcgccgcccacggcaattcgctgcgcgcgctggtcaagcatctggatcatctgagcgaa
agtgagattatcgagctgaatatcccgaccggggttccgctggtgtatgagtttgacgcc
gatatgcagccgctgcgccactactaccttggcgacgccgacgagattgccgcccgccaa
aacgccgtcgccaatcagggcaaggcgggctaa

DBGET integrated database retrieval system