KEGG   Edwardsiella tarda EIB202: ETAE_2587Help
Entry
ETAE_2587         CDS       T01121                                 

Gene name
sdhD
Definition
(GenBank) succinate dehydrogenase cytochrome b556 small membrane subunit
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
etr  Edwardsiella tarda EIB202
Pathway
etr00020  Citrate cycle (TCA cycle)
etr00190  Oxidative phosphorylation
etr00650  Butanoate metabolism
etr01100  Metabolic pathways
etr01110  Biosynthesis of secondary metabolites
etr01120  Microbial metabolism in diverse environments
etr01130  Biosynthesis of antibiotics
etr01200  Carbon metabolism
Module
etr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
etr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
etr_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:etr00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ETAE_2587 (sdhD)
   00650 Butanoate metabolism
    ETAE_2587 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    ETAE_2587 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS Fumarate_red_C
Motif
Other DBs
NCBI-ProteinID: ACY85422
UniProt: D0ZC83
Position
complement(2719160..2719507)
Genome map
AA seq 115 aa AA seqDB search
MVSNASALGRNGIQDWLLLRASAIIITLYVIYLLAFVVGAGPLTYTLWLDFFSSRITQVF
TLLTLLCILIHAWIGMWQVLTDYVKPLALRLVLQLAIVVVLVVYLVYGTLVVWGI
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtaagcaacgcatcggcgctggggcgcaacggtattcaggactggctgctgctgcgc
gcatccgccatcatcatcacgctgtacgttatctatctgctggccttcgtggtcggcgca
ggcccgctcacctatacgctgtggcttgatttcttctcttcgcggatcacccaggtgttt
accctgctgaccctgctgtgcatcctgatccatgcctggatcgggatgtggcaggtcttg
accgactacgtcaagccgctggcgctgcgtctggtgctacagctggcgatcgtggtggtc
ctggtggtctatctggtttacggaacattggttgtgtgggggatatag

DBGET integrated database retrieval system