KEGG   Edwardsiella tarda EIB202: ETAE_2704Help
Entry
ETAE_2704         CDS       T01121                                 

Definition
lysophospholipase L1
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
etr  Edwardsiella tarda EIB202
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:etr00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    ETAE_2704
Enzymes [BR:etr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     ETAE_2704
   3.1.2  Thioester hydrolases
    3.1.2.-  
     ETAE_2704
Lipid biosynthesis proteins [BR:etr01004]
 Fatty acid synthase
  Component type
   ETAE_2704
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2840351..2840968
Genome map
AA seq 205 aa AA seqDB search
MVVMILCGLTAARADTLLVLGDSLSAAYRLPEQQGWVARLAQQWQLRTPPLTVINASISG
DTAEQGLLRLPELLQQHRPRWVLIELGANDGLHGIAPDAIAAALSAIIERVQRAGATPLL
MQIRLPPNYGRRYGDAFAAIYPQLAARFGVALLPFYMEAVVGHPDWIQDDGLHPNALAQP
FIADWMAQRLLPQLTRAENGAPSIN
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atggtggtcatgatcctgtgtggcctgacggcggcccgtgccgatacactgctggtgctg
ggagacagcctgagcgccgcctatcgcctgccggagcagcagggctgggttgcccgcctg
gcccagcaatggcagctgcgcaccccgccgctgacggtgatcaacgccagcatcagcggc
gataccgccgagcaggggctgctgcgcctgccggagctgttgcagcagcaccggccgcgc
tgggtgctgattgaactgggggccaacgatgggctgcacggcattgcgcccgacgccatc
gccgctgcgctgtccgcgatcatcgagcgggtgcagcgggccggcgccaccccgctgctg
atgcagatccgcctaccgcccaactacggtcggcgctacggcgacgcctttgcggcgatc
taccctcagctggccgcgcgctttggcgtcgcgctgctgccgttttatatggaagcggtg
gtcggccaccccgactggatccaggatgacggcctgcaccccaacgcactggcccagccg
tttatcgccgactggatggcgcagcgcctgctgccgcagctaacgcgcgcggagaacggc
gcgccgtctattaattaa

DBGET integrated database retrieval system