KEGG   Edwardsiella tarda EIB202: ETAE_2875Help
Entry
ETAE_2875         CDS       T01121                                 

Definition
protein-L-isoaspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
etr  Edwardsiella tarda EIB202
Brite
Enzymes [BR:etr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     ETAE_2875
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3027399..3028037)
Genome map
AA seq 212 aa AA seqDB search
MVDVDRRVLLLIQQLMRQGIRDEAVLKAIASVPRERFIDEAMSHKAYDNTALPIGLGQTI
SQPYMVARMTELLALQAASRVLEIGTGSGYQTAVLAHLVPHVYSVERIKSLQWQAKRRLK
QLDLHNVSTRHGDGWQGWASRGPFDAIIVTAAAPEIPPALLAQLAEGGRLVLPVGEQSQP
QFLRRIQRRGDEYLVESIEPVRFVPLVSGELA
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atggtagacgtcgatcgccgggttctgctgctgatccagcagctgatgcgtcagggaatc
cgcgatgaggcggtgctgaaggctatcgcctcggtgccgcgcgaacgctttatcgatgag
gccatgtcccataaggcctatgacaacacggcgctgccgatagggttaggacagaccatc
tcccagccctatatggtggcgcggatgaccgagctgctggcgctgcaggcagcctcgcgg
gtgctggagatcggcaccggctccggctatcagacggcggtgctggcgcacctggtgcct
catgtctattcggtcgagcggatcaagagcctgcaatggcaggctaaacggcgtcttaag
cagctggatttacacaatgtatcgacccgccacggcgatggttggcagggctgggcgtcg
cgcggccccttcgatgccattattgtgaccgccgccgccccggagatcccgccggcgctg
ctggcgcaattggccgaggggggacgcctggtgctgccggtcggtgagcagtcccagccc
cagtttttacggcgtatccagcggcgcggcgacgaatacctggtcgaatcgatcgaaccg
gtgcgctttgtcccgctggtgagcggcgagctggcttga

DBGET integrated database retrieval system