KEGG   Edwardsiella tarda EIB202: ETAE_2973Help
Entry
ETAE_2973         CDS       T01121                                 

Definition
beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
etr  Edwardsiella tarda EIB202
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:etr00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3135219..3136619)
Genome map
AA seq 466 aa AA seqDB search
MGFPEGFLWGAATAAYQVEGAHEADGKGLSVWDVYSHQPGTTYQGSNGDVAADHYHRFRE
DIALMAELGMTSYRFSLSWSRLLPEGTGRVNEAGVRFYSELIDALLQHNIRPMITLYHWD
LPQALQDRFGGWADRRIVDAFEEYASLCYARFGDRVDLWSTFNETIVFIGMGYFTGQHPP
GLKDPRVGIQACHHVFLANARAVKRFREMGVAGQIGFVNVMQPNDPISQRPEDLRACALA
EGIYTHWLFDPVLKGSYPSELLAMAQQAFGVPQFAPGDAALLRENTVDFIGLNYYKREMI
AANEDIQGFDLNTSGEKGSGGGMGFKGLFKIVRNPDGVYSDWDWEIYPQGLTEAIARICR
RYGEIPIYITENGLGAKDPIIDDEIADQPRIDYLRDHIAAVEQAIAEGADVRGYYPWSFI
DLLSWLNGYQKQYGFVYVDRQRDLARRKKRSFYWYQQVIRSNGAQR
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgggatttcccgaggggtttttgtggggggcggcgacggcggcttatcaggttgaaggg
gcgcatgaagccgacggcaagggactgtccgtgtgggacgtttactcgcatcagcctggc
acgacctaccagggcagcaacggtgatgtggcggccgaccactatcaccgctttcgtgag
gatatcgccttgatggccgagctggggatgacctcataccgcttctcgctctcgtggtcg
cggctgctgccggagggaaccgggcgggtcaatgaggcgggcgtgcgcttttacagcgag
cttatcgatgcgctgctgcagcacaatatccgcccgatgatcacgctataccactgggat
ctgccgcaggcgctgcaggatcgcttcggcggctgggccgatcgtcgtatcgtggatgcc
tttgaggagtacgccagcctgtgttacgcccgcttcggcgatcgggtcgatctgtggtcg
acctttaacgaaaccattgtctttatcggtatggggtactttaccggccagcatcctccg
gggctgaaggatccgcgcgtcggtattcaggcctgtcaccatgtatttctggccaacgcg
cgggcggtaaagcgttttcgcgagatgggcgtggctgggcagatcggcttcgttaacgtg
atgcagccgaacgatcccatcagccagcgtcccgaggatctgcgcgcctgcgcactggcc
gaggggatctacacccactggctgttcgatccggtgctgaagggtagctatccgtcggag
ctgctggcgatggcgcagcaggcgtttggcgtaccgcagtttgccccgggcgatgcggcg
ctgctgcgggagaacaccgtcgattttattgggctgaactactacaaacgcgagatgatc
gccgccaatgaggatatacagggctttgatctcaataccagcggagagaagggcagcggc
ggcggcatggggtttaaggggctgtttaagatcgtacgcaaccccgatggtgtttactcc
gactgggactgggagatctatccgcaggggctgacggaggcgattgcgcgcatctgtcgg
cgctacggcgagatccccatttacatcaccgaaaacgggctgggggccaaagatcccatc
atcgacgatgagatagccgaccagccccgtatcgactacctgcgcgaccatatcgccgcc
gtcgagcaggccatcgccgaaggcgccgacgtgcgcggctactacccttggtcgtttatc
gatctgctctcgtggctaaacggttaccagaagcagtatggcttcgtgtatgtcgatcgg
cagcgggatctggcacggcgcaagaagcgcagcttctactggtatcagcaggtgatccgc
agcaacggcgctcagcgttaa

DBGET integrated database retrieval system