KEGG   Edwardsiella tarda EIB202: ETAE_3343Help
Entry
ETAE_3343         CDS       T01121                                 

Definition
lysophospholipase
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
etr  Edwardsiella tarda EIB202
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:etr00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    ETAE_3343
Enzymes [BR:etr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     ETAE_3343
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3522319..3523344)
Genome map
AA seq 341 aa AA seqDB search
MSSMIHGWLTRERGFAAFTTGPLLDFWQRRREGEFCGVDGVAIRYVAFCDARHTRAILIA
PGRIESYMKYPELAYDLFVSGYDVVIIDHRGQGTSERMLADSHRGHVERFDDYVDDLQQL
WQRELLARPYRQRFLLAHSMGGAISALFLARRPAGLTAAALCAPMTGIRLPLPRWLANGI
LSWAARRRARRTRYALGTGYWRPLPFMVNELTHSRVRYRRFLRYYSDYPQLQVGGPTYQW
VAESLAAAERIQRVAPEIVTPLLLLQAAEDRVVDNASQLRFCQTLAAAGNAPWGGAPLVI
KGARHEILFERDSQRAEALTAIVRFFKQFSESPAPIAANPC
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgtcttccatgatccacggctggctgacgcgtgagcgtggctttgctgcgtttacgacc
ggcccgctgctggatttttggcagcggcgccgagagggcgaattctgcggcgttgacggc
gtagcgatccgctacgtggccttttgcgatgcgcggcacacccgcgcgatactgatcgcc
ccggggcgcattgaaagctatatgaaatatccggagctggcctacgatctgtttgtgagt
ggctatgatgtagtgatcatcgaccaccgcggccagggaacctccgagcggatgctggcc
gactcgcaccgcggccacgtggagcgctttgacgactacgtggatgatctgcagcagctg
tggcagcgcgagctgctggcgcgcccctatcggcagcgtttcttactggcgcactcgatg
ggcggcgcgatcagcgctctgtttctggcccgccgccccgcggggctgaccgccgcggcg
ctgtgtgcgccgatgaccgggatccgcctgccgctgccgcgctggctggcgaatggcata
ttgagctgggccgcgcgccgccgcgcgcgccgcacccgctatgccttgggcaccggctac
tggcgtcccctgccatttatggttaacgaactcacgcacagccgggtgcgatatcgtcgt
tttttgcgctattattctgactatccacagctgcaggtgggcgggccgacctatcagtgg
gtcgccgaaagcctggccgccgccgaacggatccagcgcgtggcgccggagattgtcacg
ccgctgctgctgctgcaggccgcagaggatcgcgtggtggataatgcgtcacagctgcgt
ttttgtcagacactcgccgccgccggcaacgccccctggggcggtgcgccgctggttatc
aagggtgcacgccatgagatcctgtttgaacgggacagccagcgtgccgaagcgctaacc
gctatcgtgcggttttttaaacaattttctgaatcgccggcacctattgccgccaacccc
tgctga

DBGET integrated database retrieval system