KEGG   Edwardsiella tarda EIB202: ETAE_3382Help
Entry
ETAE_3382         CDS       T01121                                 

Definition
endo-1,4-D-glucanase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
etr  Edwardsiella tarda EIB202
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:etr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ETAE_3382
Enzymes [BR:etr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     ETAE_3382
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3571376..3572497)
Genome map
AA seq 373 aa AA seqDB search
MKESVCRTLMAAALLCVSVATVGAPCEWHEWEQFRQGYISPDGRVIDPSSPRQITTSEGQ
SYALFFALVNNDRPLFANLLAWTQNNLAQGSLRQHLPAWKWGRHDDGRWRILDNNSAADA
DLWIAYALLEAGRLWQDADYQHLGIQLLARIAREEVVSLPGFGMMLLPGRQGFRSGALWT
VNPSYLPPQILARIAPLHGPWNRLQYSALRMLEASSPQGIVPDWTNWQRNKGWLPTPGRA
YISGYDAIRAYLWAGMLADGAPAKSALVKHWQPMVALSERLGYIPEKVSVLGAQPQGEGN
VGFSAAMLPFLDASNSPLLAAQRQRVKDNPPGNNNYYSSVLTLFGLGWDQRRYRFNLQGE
LVPNWGAVCDVSD
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgaaggagtcggtctgccgtacattgatggctgccgcattgctgtgtgtcagcgtcgcc
accgtaggcgcgccctgtgaatggcatgagtgggaacagtttcgtcagggctatatcagc
cctgacgggcgagttatcgatcccagctctcctcgccagataaccacctcggaggggcaa
agctatgcgctgttctttgccctggtcaataacgatcgcccgttgttcgctaatctattg
gcctggacgcagaataacctggcgcagggcagcctgcgccagcatttgccggcctggaag
tgggggcgccatgatgacgggcgctggcgcatattggataacaactccgccgcggatgcc
gacctgtggatagcctatgcgctgctggaggccggacgcctgtggcaggatgccgattac
caacatttgggcattcagctgctggcgcggattgcccgggaggaggtggtctcgctgccg
gggtttggcatgatgctgctgccgggtcgccaggggttccgctccggcgccctgtggacg
gtaaatccaagctatctaccaccgcagatcctggcccggattgcgccgttgcatgggccg
tggaatcgcctgcagtacagcgcgctgcgtatgttagaggcgtcgtcgccgcagggtatc
gtgccggattggaccaactggcagcggaataagggctggctgccgacgccggggcgggcc
tatatcagcggctatgatgctatccgggcctatctgtgggcgggaatgctggccgacggc
gcgccggccaaaagcgcgctggtgaagcactggcagccgatggtggcgctgagtgagcgt
ctgggatatatccctgaaaaggtcagcgtgctgggcgcgcagccccagggcgaaggcaac
gtcgggttctctgccgccatgctaccgtttctggacgccagcaacagcccgctattggcg
gcgcagcgccagcgggtaaaagataacccgccggggaataataactactacagttcagtc
ctgacgctgtttggcctgggatgggatcagcggcgttaccgttttaatctacagggcgaa
ctggtgccaaactggggtgccgtatgcgatgtttccgactga

DBGET integrated database retrieval system