KEGG   Edwardsiella tarda EIB202: ETAE_3382Help
Entry
ETAE_3382         CDS       T01121                                 

Definition
(GenBank) endo-1,4-D-glucanase
  KO
K20542  
endoglucanase [EC:3.2.1.4]
Organism
etr  Edwardsiella tarda EIB202
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(3571376..3572497)
Genome map
AA seq 373 aa AA seqDB search
MKESVCRTLMAAALLCVSVATVGAPCEWHEWEQFRQGYISPDGRVIDPSSPRQITTSEGQ
SYALFFALVNNDRPLFANLLAWTQNNLAQGSLRQHLPAWKWGRHDDGRWRILDNNSAADA
DLWIAYALLEAGRLWQDADYQHLGIQLLARIAREEVVSLPGFGMMLLPGRQGFRSGALWT
VNPSYLPPQILARIAPLHGPWNRLQYSALRMLEASSPQGIVPDWTNWQRNKGWLPTPGRA
YISGYDAIRAYLWAGMLADGAPAKSALVKHWQPMVALSERLGYIPEKVSVLGAQPQGEGN
VGFSAAMLPFLDASNSPLLAAQRQRVKDNPPGNNNYYSSVLTLFGLGWDQRRYRFNLQGE
LVPNWGAVCDVSD
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgaaggagtcggtctgccgtacattgatggctgccgcattgctgtgtgtcagcgtcgcc
accgtaggcgcgccctgtgaatggcatgagtgggaacagtttcgtcagggctatatcagc
cctgacgggcgagttatcgatcccagctctcctcgccagataaccacctcggaggggcaa
agctatgcgctgttctttgccctggtcaataacgatcgcccgttgttcgctaatctattg
gcctggacgcagaataacctggcgcagggcagcctgcgccagcatttgccggcctggaag
tgggggcgccatgatgacgggcgctggcgcatattggataacaactccgccgcggatgcc
gacctgtggatagcctatgcgctgctggaggccggacgcctgtggcaggatgccgattac
caacatttgggcattcagctgctggcgcggattgcccgggaggaggtggtctcgctgccg
gggtttggcatgatgctgctgccgggtcgccaggggttccgctccggcgccctgtggacg
gtaaatccaagctatctaccaccgcagatcctggcccggattgcgccgttgcatgggccg
tggaatcgcctgcagtacagcgcgctgcgtatgttagaggcgtcgtcgccgcagggtatc
gtgccggattggaccaactggcagcggaataagggctggctgccgacgccggggcgggcc
tatatcagcggctatgatgctatccgggcctatctgtgggcgggaatgctggccgacggc
gcgccggccaaaagcgcgctggtgaagcactggcagccgatggtggcgctgagtgagcgt
ctgggatatatccctgaaaaggtcagcgtgctgggcgcgcagccccagggcgaaggcaac
gtcgggttctctgccgccatgctaccgtttctggacgccagcaacagcccgctattggcg
gcgcagcgccagcgggtaaaagataacccgccggggaataataactactacagttcagtc
ctgacgctgtttggcctgggatgggatcagcggcgttaccgttttaatctacagggcgaa
ctggtgccaaactggggtgccgtatgcgatgtttccgactga

DBGET integrated database retrieval system