KEGG   Edwardsiella tarda EIB202: ETAE_3442Help
Entry
ETAE_3442         CDS       T01121                                 

Gene name
glpK
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
etr  Edwardsiella tarda EIB202
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:etr00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    ETAE_3442 (glpK)
Enzymes [BR:etr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     ETAE_3442 (glpK)
Exosome [BR:etr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ETAE_3442 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3630375..3631883
Genome map
AA seq 502 aa AA seqDB search
MTTEQKYIVALDQGTTSSRAVILDHDANIISASQREFEQIYPKAGWVEHDPMEIWATQSS
TLTEAMAKADIESDQIAAIGITNQRETTIVWEKETGKPVYNAIVWQCRRTADICEKLKRD
GLEEYIRHNTGLVVDPYFSGTKVKWILDHVDGARERAQRGELLFGTVDTWLVWKMTQGRV
HVTDYTNASRTMLFNIHTLDWDERMLEVLDIPRAMLPQVRASSEIYGKTNIGGKGGTRIP
IAGIAGDQQAALFGQLCVQPGMAKNTYGTGCFLLMNTGKEAVPSQHGLLTTIACGPRGEV
NYALEGAVFIGGASIQWLRDELKLINDAADSEYFATKVKDSNGVYVVPAFTGLGAPYWDP
YARGAIFGLTRGVNNNHIIRATLESIAYQTRDVLDAMQADANTRLQSLRVDGGAVANNFL
MQFQSDILGTRVERPAVLEVTALGAAYLAGLAVGYWSDLEELSSKASIEREFRPGIETVE
RNYRYSGWKKAVARAQAWEDHD
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgacaaccgaacaaaaatacattgtcgctcttgaccagggcaccaccagctcccgcgcc
gtgatcctcgaccacgatgccaatatcatcagcgcctcccagcgcgagttcgaacagatt
taccccaaggccggctgggtggagcacgacccgatggagatctgggcgacccagagctct
accctcacggaggcgatggccaaagccgatatcgaatccgatcagattgccgccatcggc
atcaccaaccagcgtgaaaccactatcgtctgggaaaaagagaccggtaaaccggtctac
aacgccatcgtctggcagtgccgtcgtaccgccgatatctgtgaaaagctcaagcgcgac
ggactggaggagtacatccgccacaacaccggcctggtggtcgacccctacttctccggc
accaaggtgaagtggatcctggaccatgtcgacggcgcccgcgaacgcgcccagcgcggc
gaactgctgttcggcaccgtcgatacctggctggtatggaagatgacccaagggcgggta
cacgtcaccgactacaccaacgcctctcgcaccatgctgttcaacatccacacgctggac
tgggatgagcgcatgctggaggtgctggatatcccgcgcgcaatgctgccgcaggtacgc
gcctcttccgaaatctatggaaaaaccaacatcggcggcaagggtggaacccgtatccct
atcgccggtatcgccggtgaccagcaggcggcgctgtttggccaactgtgtgtgcagccg
gggatggcgaagaacacctacggcaccggctgcttcctgctgatgaacaccggtaaagag
gcggtaccgtcacagcacggcctgctgaccaccatcgcctgtggtccgcgcggcgaggtg
aactacgcactggagggggcggtcttcatcggcggcgcctcgattcagtggctgcgcgac
gagctgaagctcatcaacgatgcggcggactccgagtactttgctaccaaggtaaaagac
agcaatggcgtctacgtggtgccggcctttaccggcctgggcgccccttactgggacccc
tatgcccgcggcgccatctttggcctgacccgcggcgtcaacaataaccacatcatccgc
gcgaccctggagtccatcgcctaccagacccgcgacgtactggatgccatgcaggccgac
gccaatacccgtctgcagtccctgcgcgtcgacggcggcgcggtcgctaacaacttcctg
atgcagttccagtcagacatcctcgggacgcgggttgaacgcccggcggtcctggaggtc
acggcgctcggcgcggcctatctggccggtctggccgtcggctactggagcgatctggag
gagctgagcagcaaggccagcattgagcgtgagttccgccctggcattgaaaccgtcgag
cgcaactatcgctacagcggctggaagaaagcggtggcgcgcgcgcaggcctgggaagat
cacgactga

DBGET integrated database retrieval system