KEGG   Edwardsiella tarda EIB202: ETAE_3449Help
Entry
ETAE_3449         CDS       T01121                                 

Gene name
tpiA
Definition
(GenBank) Triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
etr  Edwardsiella tarda EIB202
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:etr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ETAE_3449 (tpiA)
   01230 Biosynthesis of amino acids
    ETAE_3449 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ETAE_3449 (tpiA)
   00051 Fructose and mannose metabolism
    ETAE_3449 (tpiA)
   00562 Inositol phosphate metabolism
    ETAE_3449 (tpiA)
Enzymes [BR:etr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     ETAE_3449 (tpiA)
Exosome [BR:etr04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   ETAE_3449 (tpiA)
  Exosomal proteins of bladder cancer cells
   ETAE_3449 (tpiA)
  Exosomal proteins of melanoma cells
   ETAE_3449 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
3637381..3638145
Genome map
AA seq 254 aa AA seqDB search
MRQPLVMGNWKLNGSRHMVHELVAALRGELSDVANCDVAIAPPAVYLDMAAHELAGSRIA
LGAQDVGINASGAFTGEISAAMLKDIGAKYIIIGHSERRTYHKEGDAFIAEKFAALKEAG
LIPVLCIGETEAENEAGKTEEVCARQLDAVLKTMGAQVFKGAVIAYEPIWAIGTGKSATP
EQAQAVHKFIRDHVAKHDAEAAQEVIIQYGGSVNAANAADLFKQPDIDGALVGGASLKAD
AFATIVRAAAAAKA
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcaaccattagttatgggtaactggaaactgaacggtagccgccacatggttcac
gaactggttgccgccctgcgcggtgaactgagcgacgtagcaaactgcgatgtcgccatc
gccccgccggcagtctatctggatatggccgcccatgaactggccggtagccgtatcgcc
ctcggtgcccaggacgtcggtatcaatgcctccggcgcattcaccggtgaaatctccgcc
gcgatgctgaaagacatcggtgccaaatacatcatcattggccactcagagcgccgtacc
taccacaaagaaggcgacgcgttcatcgcagagaaatttgccgcgctgaaagaagccggt
ctgatcccggtgctgtgcatcggtgagacggaagctgaaaacgaagccggtaaaacggaa
gaagtctgcgcccgccagctggatgccgtactgaaaaccatgggtgctcaggtgtttaaa
ggcgccgttatcgcctatgaaccgatatgggccatcggtaccggtaagtctgccactccg
gaacaggctcaggcggtacacaaatttatccgcgatcacgttgccaagcacgacgctgaa
gccgcacaggaagtcatcatccagtacggcggctcagtcaacgcagccaatgcggccgat
ctgttcaagcagccggacatcgacggtgcactggtcggcggggcctctctgaaggccgac
gcattcgccaccatcgtacgcgccgccgctgccgctaaagcctaa

DBGET integrated database retrieval system