KEGG   Edwardsiella tarda EIB202: ETAE_3450Help
Entry
ETAE_3450         CDS       T01121                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
etr  Edwardsiella tarda EIB202
Pathway
etr00010  Glycolysis / Gluconeogenesis
etr00030  Pentose phosphate pathway
etr00051  Fructose and mannose metabolism
etr00052  Galactose metabolism
etr00680  Methane metabolism
etr01100  Metabolic pathways
etr01110  Biosynthesis of secondary metabolites
etr01120  Microbial metabolism in diverse environments
etr01130  Biosynthesis of antibiotics
etr01200  Carbon metabolism
etr01230  Biosynthesis of amino acids
etr03018  RNA degradation
Module
etr_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:etr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ETAE_3450
   00030 Pentose phosphate pathway
    ETAE_3450
   00051 Fructose and mannose metabolism
    ETAE_3450
   00052 Galactose metabolism
    ETAE_3450
  Energy metabolism
   00680 Methane metabolism
    ETAE_3450
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    ETAE_3450
Enzymes [BR:etr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     ETAE_3450
Protein phosphatases and associated proteins [BR:etr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     ETAE_3450
Messenger RNA biogenesis [BR:etr03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     ETAE_3450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase
Motif
Other DBs
NCBI-ProteinID: ACY86281
UniProt: D0ZGW0
Position
complement(3638278..3639240)
Genome map
AA seq 320 aa AA seqDB search
MIKKIGVLTSGGDAPGMNAAIRGVVRAALSKGLDVYGIHDGYLGLYEGRIEQLDRYSVSD
VINRGGTFLGSARFPEFRDEKVREKAVENMREFGLDALVVIGGDGSYLGAKRLTEMGFPC
IGLPGTIDNDVAGTDYTIGYFTALETVVEAIDRLRDTSSSHQRISIVEVMGRYCGDLTLA
AAIAGGCEYIVLPEVEFKREELVEEIKAGITKGKKHAIVAITEHICDVDELAKFIEQETG
RETRSTVLGHIQRGGAPVAYDRILASRMGAYSIELLLQGYGGRCVGIQNEKLVHHDIIDA
VENMKRPFKGDWLDTAKILF
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaaaaaatcggtgttttgaccagtggcggtgacgcgccgggcatgaacgcggcc
atccgcggcgtcgtgcgtgcggccttgtccaaagggttagacgtttacggcatccatgat
ggctacctcggtctgtatgaaggacgcattgagcaactggaccgctacagcgtctccgac
gtgatcaaccgcggcggtactttccttggctcagcccgtttcccggagtttcgcgacgag
aaagtgcgtgaaaaggccgtagagaacatgcgtgagtttggcctggatgcgctggtggtg
atcggcggtgacggttcctatttgggcgctaagcgcttgactgagatggggttcccctgc
attggcctgccgggaactatcgataacgatgtggccggcaccgattacaccatcgggtat
tttacggcgctggaaaccgttgtagaggccattgaccgtctgcgcgatacctcctcttca
caccagcgtatctccatcgtcgaggtgatggggcgttactgtggcgacctgacgctggcg
gcggcgatcgccggcggctgcgaatatatcgtgctgccggaggtggagttcaagcgcgaa
gagctggtcgaagagattaaggccggcatcactaaaggcaagaaacacgctatcgttgcc
atcaccgagcatatctgtgatgtggatgagctggccaagtttatcgagcaggagaccggt
cgtgaaactcgctcgaccgtactgggacatatccagcgcggcggtgcgccggtggcctat
gaccgcatcctcgcgtcgcgcatgggcgcctactccattgagctgctgctgcagggatac
ggcggccgctgcgtggggatccagaacgaaaagctggtgcaccacgacatcatcgatgcg
gttgaaaatatgaagcgtccgtttaagggcgattggctggatacggccaagatactgttc
taa

DBGET integrated database retrieval system