KEGG   Edwardsiella tarda EIB202: ETAE_3450Help
Entry
ETAE_3450         CDS       T01121                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
etr  Edwardsiella tarda EIB202
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:etr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ETAE_3450
   01230 Biosynthesis of amino acids
    ETAE_3450
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ETAE_3450
   00030 Pentose phosphate pathway
    ETAE_3450
   00051 Fructose and mannose metabolism
    ETAE_3450
   00052 Galactose metabolism
    ETAE_3450
  Energy metabolism
   00680 Methane metabolism
    ETAE_3450
Enzymes [BR:etr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     ETAE_3450
Protein phosphatases and associated proteins [BR:etr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     ETAE_3450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3638278..3639240)
Genome map
AA seq 320 aa AA seqDB search
MIKKIGVLTSGGDAPGMNAAIRGVVRAALSKGLDVYGIHDGYLGLYEGRIEQLDRYSVSD
VINRGGTFLGSARFPEFRDEKVREKAVENMREFGLDALVVIGGDGSYLGAKRLTEMGFPC
IGLPGTIDNDVAGTDYTIGYFTALETVVEAIDRLRDTSSSHQRISIVEVMGRYCGDLTLA
AAIAGGCEYIVLPEVEFKREELVEEIKAGITKGKKHAIVAITEHICDVDELAKFIEQETG
RETRSTVLGHIQRGGAPVAYDRILASRMGAYSIELLLQGYGGRCVGIQNEKLVHHDIIDA
VENMKRPFKGDWLDTAKILF
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaaaaaatcggtgttttgaccagtggcggtgacgcgccgggcatgaacgcggcc
atccgcggcgtcgtgcgtgcggccttgtccaaagggttagacgtttacggcatccatgat
ggctacctcggtctgtatgaaggacgcattgagcaactggaccgctacagcgtctccgac
gtgatcaaccgcggcggtactttccttggctcagcccgtttcccggagtttcgcgacgag
aaagtgcgtgaaaaggccgtagagaacatgcgtgagtttggcctggatgcgctggtggtg
atcggcggtgacggttcctatttgggcgctaagcgcttgactgagatggggttcccctgc
attggcctgccgggaactatcgataacgatgtggccggcaccgattacaccatcgggtat
tttacggcgctggaaaccgttgtagaggccattgaccgtctgcgcgatacctcctcttca
caccagcgtatctccatcgtcgaggtgatggggcgttactgtggcgacctgacgctggcg
gcggcgatcgccggcggctgcgaatatatcgtgctgccggaggtggagttcaagcgcgaa
gagctggtcgaagagattaaggccggcatcactaaaggcaagaaacacgctatcgttgcc
atcaccgagcatatctgtgatgtggatgagctggccaagtttatcgagcaggagaccggt
cgtgaaactcgctcgaccgtactgggacatatccagcgcggcggtgcgccggtggcctat
gaccgcatcctcgcgtcgcgcatgggcgcctactccattgagctgctgctgcagggatac
ggcggccgctgcgtggggatccagaacgaaaagctggtgcaccacgacatcatcgatgcg
gttgaaaatatgaagcgtccgtttaagggcgattggctggatacggccaagatactgttc
taa

DBGET integrated database retrieval system