KEGG   Escherichia coli O157 H7 TW14359 (EHEC): ECSP_0143Help
Entry
ECSP_0143         CDS       T00949                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
etw  Escherichia coli O157:H7 TW14359 (EHEC)
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:etw00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(161553..162035)
Genome map
AA seq 160 aa AA seqDB search
MTVAYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQPDYLNAAVA
LETTLAPEELLNHTQQIELQQGRVRKAERWGPRTLDLDIMLFGNETINTERLTVPHYDMK
NRGFMLWPLFEIAPELVFPDGETLREILTSLAVLQPAIWY
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgacagtggcgtatattgccataggcagcaatctggcctctccgctggagcaggtcaat
gctgccctgaaagcattaggcgatatccctgaaagccacattcttaccgtttcttcgttt
taccgcaccccaccgctggggccgcaagatcaacccgattacttaaacgcagccgtggcg
ctggaaacaacacttgcgcctgaagaattacttaatcacacacagcaaatagagttgcag
caaggtcgcgttcgtaaagcagaacgctggggaccgcgcacactcgatcttgatatcatg
ttgtttggtaatgaaaccattaataccgaacgactcaccgtcccgcattacgatatgaag
aatcgcggctttatgctgtggccgctgtttgagattgccccggaactcgtgtttcctgat
ggggagacattacgtgaaatactcacttcgctagcagtactacaacctgccatctggtat
tag

DBGET integrated database retrieval system