KEGG   Escherichia coli O157 H7 TW14359 (EHEC): ECSP_2291Help
Entry
ECSP_2291         CDS       T00949                                 

Gene name
pfkB
Definition
6-phosphofructokinase
Orthology
K16370  
6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
etw  Escherichia coli O157:H7 TW14359 (EHEC)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:etw00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ECSP_2291 (pfkB)
   01230 Biosynthesis of amino acids
    ECSP_2291 (pfkB)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ECSP_2291 (pfkB)
   00030 Pentose phosphate pathway
    ECSP_2291 (pfkB)
   00051 Fructose and mannose metabolism
    ECSP_2291 (pfkB)
   00052 Galactose metabolism
    ECSP_2291 (pfkB)
  Energy metabolism
   00680 Methane metabolism
    ECSP_2291 (pfkB)
Enzymes [BR:etw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     ECSP_2291 (pfkB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2311359..2312288
Genome map
AA seq 309 aa AA seqDB search
MVRIYTLTLAPSLDSATITPQIYPEGKLRCTAPVFEPGGGGINVARAIAHLGGSATAIFP
AGGATGEHLVSLLADENVPVATVEAKDWTRQNLHVHVEASGEQYRFVMPGAALNEDEFRQ
LEEQVLEIESGAILVISGSLPPGVKLEKLTQLISAAQNQGIRCIIDSSGEALSAALAIGN
IELVKPNQKELSALVNRELTQPDDVRKAAQEIVNSGKAKRVVVSLGPQGALGVDSENCIQ
VVPPPVKSQSTVGAGDSMVGAMTLKLAENASLEEMVRFGVAAGSAATLNQGTRLCSHDDT
QKIYAYLSR
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atggtacgtatctatacgttgacacttgcgccctctctcgatagcgcaacaattaccccg
caaatttatcccgaaggaaaactgcgctgtaccgcaccggtgttcgaacccgggggcggc
ggcatcaacgtcgcccgcgccattgcccatcttggaggcagtgccacagcgatcttcccg
gcgggtggcgcgaccggcgaacacctggtttcactgttggcggatgaaaatgtccccgtc
gctactgtagaagccaaagactggacccggcagaatttacacgtacatgtggaagcaagc
ggtgagcagtatcgttttgttatgccaggcgcggcattaaatgaagatgagtttcgccag
cttgaagagcaagttctggaaattgaatccggggccatcctggtcataagcggaagcctg
ccgccaggtgtgaagctggaaaaattaacccaactgatttccgctgcgcaaaaccaaggg
atccgctgcatcatcgacagttctggcgaagcgttaagtgcagcactggcgattggtaac
atcgagttggttaagcctaaccaaaaagaactcagtgcgctggtgaatcgcgaactcacc
cagccagacgatgtccgcaaagccgcgcaggaaatcgttaatagcggcaaggccaaacgg
gttgtcgtttccctgggtccacaaggagcgctgggtgttgatagtgaaaactgcattcag
gtggtgccaccaccggtgaaaagccagagtaccgttggcgctggtgatagcatggtcggc
gcgatgacactgaaactggcagaaaatgcctctcttgaagagatggttcgttttggcgta
gctgcggggagtgcagccacactcaatcagggaacacgtctgtgctcccatgacgatacg
caaaaaatttacgcttacctttcccgctaa

DBGET integrated database retrieval system