KEGG   Escherichia coli O157 H7 TW14359 (EHEC): ECSP_2554Help
Entry
ECSP_2554         CDS       T00949                                 

Gene name
fliR
Definition
flagellar biosynthesis protein FliR
Orthology
K02421  
flagellar biosynthetic protein FliR
Organism
etw  Escherichia coli O157:H7 TW14359 (EHEC)
Pathway
Flagellar assembly
Class
Cellular Processes; Cell motility; Flagellar assembly [PATH:etw02040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2554031..2554816
Genome map
AA seq 261 aa AA seqDB search
MLQVTSEQWLSWLSLYFWPLLRVLALISTAPILSERSVPKRVKLGLAMMITFAIAPSLPA
NDVPVFSFFALWLAVQQILIGIALGFTMQFAFAAVRTAGEIIGLQMGLSFATFVDPASHL
NMPVLARIMDMLALLLFLTFNGHLWLISLLVDTFHTLPIGGEPLNSNAFLALTKAGSLIF
LNGLMLALPLITLLLTLNLALGLLNRMAPQLSIFVIGFPLTLTVGISLMAALMPLIAPFC
EHLFSEIFNLLADIISELPLI
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgttgcaggtgacaagcgaacaatggctatcctggttaagcctgtacttctggccgtta
ctgcgcgtgctggcgctgatctccaccgcgccgattctgagcgaacgcagcgtaccgaaa
cgggtaaaactgggtctggcaatgatgatcacgttcgccattgccccatcattacctgcc
aacgatgttcctgttttttcgttctttgctctgtggctggccgtgcagcagatcctgatc
ggcattgcgcttggttttaccatgcaatttgcctttgccgctgtgcgaaccgctggcgaa
attatcggtctgcaaatggggctgtcatttgcgacgtttgtcgatccggccagccatctt
aatatgcccgttttagcgcgtatcatggatatgctggcgttactgctgttcctgacattt
aacggtcatttatggttgatttcactgctggtcgatacctttcacaccctgccgattggt
ggcgaaccgttgaacagcaatgcgtttctggcactcaccaaagcagggagtttgattttc
cttaacgggctgatgctggcgttaccgctcattactctgctgctgacactgaatctggca
ttaggtttacttaatcgtatggccccgcaattatccatttttgttattggatttccatta
actctgactgtcggcatctctttaatggcggcattaatgccgttaattgcgcctttttgc
gaacatttattcagtgaaatttttaatttgctggctgatattattagtgaattgccatta
atataa

DBGET integrated database retrieval system