KEGG   Escherichia coli O157 H7 TW14359 (EHEC): ECSP_2717Help
Entry
ECSP_2717         CDS       T00949                                 

Gene name
lys
Definition
phage-related lysozyme
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
etw  Escherichia coli O157:H7 TW14359 (EHEC)
Brite
Enzymes [BR:etw01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     ECSP_2717 (lys)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2690964..2691461)
Genome map
AA seq 165 aa AA seqDB search
MSPSLRKAVAAAIGGGAVAIASVLITGPGGNDGLEGVSYIPYKDIVGVWTVCHGHTGKDI
MPGKTYTEAECKALLNKDLATVARQINPYINVDIPETTRGALYSFVYNVGAGNFRTSTLL
RKINQGDIKGACDQLRRWTYAGGKQWKGLMTRREIEREVCLWGQQ
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgtcgccgtcattacgcaaggctgttgcagctgctattggtggtggggctgttgccata
gcgtctgtgctcatcactggtccaggtggtaacgatggtctggaaggtgtcagctacata
ccatacaaagatatcgttggcgtatggactgtatgtcacggacacaccggaaaagacatc
atgcccggtaaaacgtataccgaagcagaatgcaaagccctcctgaataaagaccttgcc
acggtcgccagacaaattaacccgtacatcaacgtcgatataccggaaacaacgcgcggc
gctctttactcgttcgtttacaacgtgggcgctggcaatttcagaacatcgacgcttctt
cgcaaaataaaccagggcgatatcaaaggcgcatgtgatcagctacggcgctggacatac
gctggcggtaagcaatggaaagggctgatgactcgccgcgagattgagcgtgaagtctgt
ttgtgggggcaacaatga

DBGET integrated database retrieval system