KEGG   Escherichia coli O157 H7 TW14359 (EHEC): ECSP_3130Help
Entry
ECSP_3130         CDS       T00949                                 

Gene name
arnB
Definition
UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase
Orthology
K07806  
UDP-4-amino-4-deoxy-L-arabinose-oxoglutarate aminotransferase [EC:2.6.1.87]
Organism
etw  Escherichia coli O157:H7 TW14359 (EHEC)
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Two-component system
Brite
KEGG Orthology (KO) [BR:etw00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    ECSP_3130 (arnB)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    ECSP_3130 (arnB)
Enzymes [BR:etw01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.87  UDP-4-amino-4-deoxy-L-arabinose aminotransferase
     ECSP_3130 (arnB)
Lipopolysaccharide biosynthesis proteins [BR:etw01005]
 Unusual sugar
  ECSP_3130 (arnB)
Amino acid related enzymes [BR:etw01007]
 Aminotransferase (transaminase)
  Others
   ECSP_3130 (arnB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3092674..3093813
Genome map
AA seq 379 aa AA seqDB search
MSEFLPFSRPAMGVEELAAVKEVLESGWITTGPKNHALEQAFCQLTGNQHAIAVSSATAG
MHITLMALEIGKGDEVITPSLTWVSTLNMISLQGATPVMVDVDRDTLMVTPEAIESAITP
RTKAIIPVHYAGAPADINAIRAIGERYGIAVIEDAAHAVGTYYKGRHIGAKGTAIFSFHA
IKNITCAEGGLIVTDNENIARQLRMLKFHGLGVDAYDRQTWGRAPQAEVLTPGYKYNLTD
INAAIALTQLAKLEHLNTRRREIAQQYQQALAALPFQPLSLPAWPHVHAWHLFIIRVDEQ
RCGISRDALMEALKERGIGTGLHFRAAHTQKYYRERFPSLSLPNTEWNSERICSLPLFPD
MTTADADRVITALQQLAGQ
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaatttttgcctttttcgagaccagcaatgggcgtggaggaactcgctgcagtt
aaagaggttctcgaatccggttggatcacaaccggtccgaagaatcacgcgcttgaacaa
gccttttgccagttgacgggaaatcagcatgccatcgcggtcagttcagccaccgccgga
atgcatatcacgctaatggcgttggaaattggcaagggcgatgaagtgattacgccttcc
ctgacctgggtttcaaccctcaatatgatttccttgcagggtgcaacgccggtaatggtg
gatgtcgatcgcgatacgctgatggtcacgcctgaagcgatcgaatcagccattacgcca
cgcactaaagccatcattccggtgcattatgccggtgcgccagcagatattaacgccatt
cgcgccattggcgaacgttacggcatcgcagttatcgaagatgctgcccatgccgtaggt
acgtattacaaagggcgacatattggcgcaaaaggtaccgctattttttcatttcatgcc
attaaaaatattacctgtgcggaaggaggcctgattgttactgataatgaaaatattgcc
cgccagctacggatgctgaaatttcacggcctgggtgtcgatgcctatgacagacaaacc
tggggccgtgcaccgcaggctgaagtcttaacgccgggctataagtacaatctgaccgat
attaacgccgcgattgccctgacacagttagccaaattagagcacctcaacacccgtcgg
cgcgaaattgcccagcaatatcagcaagcactggcagctctcccctttcagccattaagc
cttcccgcctggccgcacgttcacgcctggcatctgtttattattcgtgtcgatgaacaa
cgttgtggtatcagtcgcgatgcgttgatggaagcgttaaaagaaagaggtattggtacc
gggttacatttccgcgccgctcacacacaaaaatattatcgcgagcgttttccctcgctg
tcgttaccgaataccgaatggaatagcgaacgcatctgttctttgccgctgttcccggat
atgactaccgccgatgccgaccgtgtcatcacagcccttcagcaactcgcaggacaataa

DBGET integrated database retrieval system