KEGG   Escherichia coli O157 H7 TW14359 (EHEC): ECSP_3338Help
Entry
ECSP_3338         CDS       T00949                                 

Gene name
glk
Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
etw  Escherichia coli O157:H7 TW14359 (EHEC)
Pathway
etw00010  Glycolysis / Gluconeogenesis
etw00052  Galactose metabolism
etw00500  Starch and sucrose metabolism
etw00520  Amino sugar and nucleotide sugar metabolism
etw00521  Streptomycin biosynthesis
etw01100  Metabolic pathways
etw01110  Biosynthesis of secondary metabolites
etw01120  Microbial metabolism in diverse environments
etw01130  Biosynthesis of antibiotics
etw01200  Carbon metabolism
Module
etw_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
etw_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:etw00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ECSP_3338 (glk)
   00052 Galactose metabolism
    ECSP_3338 (glk)
   00500 Starch and sucrose metabolism
    ECSP_3338 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    ECSP_3338 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    ECSP_3338 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    ECSP_3338 (glk)
Enzymes [BR:etw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     ECSP_3338 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase PaaX_C
Motif
Other DBs
NCBI-ProteinID: ACT73111
Structure
PDB: 

Jmol
Position
complement(3295582..3296547)
Genome map
AA seq 321 aa AA seqDB search
MTKYALVGDVGGTNARLALCDIASGEISQAKTYSGLDYPSLEAVIRVYLEEHKVEVKDGC
IAIACPITGDWVAMTNHTWAFSIAEMKKNLGFSHLEIINDFTAVSMAIPMLKKEHLIQFG
GAEPVEGKPIAVYGAGTGLGVAHLVHVDKRWVSLPGEGGHVDFAPNSEEEAIILEILRAE
IGHVSAERVLSGPGLVNLYRAIVKADNRLPENLKPKDITERALADSCTDCRRALSLFCVI
MGRFGGNLALNLGTFGGVFIAGGIVPRFLEFFKASGFRAAFEDKGRFKEYVHDIPVYLIV
HDNPGLLGSGAHLRQTLGHIL
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgacaaagtatgcattagtcggtgatgtgggcggcaccaacgcacgtcttgctctgtgt
gatattgccagtggtgaaatctcgcaggctaagacctattcagggcttgattaccccagc
ctcgaagcggtcattcgcgtttatcttgaagaacataaggtcgaggtgaaagacggctgt
attgccatcgcttgcccgattaccggagactgggtggcaatgaccaaccatacctgggcg
ttctcaattgccgaaatgaaaaagaatctcggttttagccatctggaaattattaacgat
tttaccgctgtatcgatggcgatcccgatgctgaaaaaagagcatctgattcagtttggt
ggcgcagaaccggtagaaggtaagcctattgcggtttacggtgccggaacggggcttggg
gttgcgcatctggtccatgtcgataagcgttgggtaagcttgccgggcgaaggcggtcac
gttgattttgcgccgaatagtgaagaagaggccattatcctcgaaatattgcgtgcggaa
attggtcatgtttcggcggaacgcgtgctttctggcccaggactggtgaatttgtatcgc
gcaattgttaaagccgacaaccgcctgccagaaaatctcaagccaaaagatattaccgaa
cgcgcgctggctgacagctgcaccgattgccgccgtgcgttgtcgctgttttgcgtcatt
atgggccgttttggcggcaatctggcgctcaatctcgggacatttggcggcgtgtttatt
gcgggcggtatcgtgccgcgcttccttgagttcttcaaagcctctggtttccgtgccgca
tttgaagataaagggcgctttaaagaatatgtccatgatattccggtgtatctcatcgtc
catgacaatccgggtcttctcggttccggtgcacatttacgccagaccttaggtcacatt
ctgtaa

DBGET integrated database retrieval system