KEGG   Escherichia coli O157 H7 TW14359 (EHEC): ECSP_5166Help
Entry
ECSP_5166         CDS       T00949                                 

Gene name
acs
Definition
(GenBank) acetyl-CoA synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
etw  Escherichia coli O157:H7 TW14359 (EHEC)
Pathway
etw00010  Glycolysis / Gluconeogenesis
etw00620  Pyruvate metabolism
etw00640  Propanoate metabolism
etw00680  Methane metabolism
etw01100  Metabolic pathways
etw01110  Biosynthesis of secondary metabolites
etw01120  Microbial metabolism in diverse environments
etw01130  Biosynthesis of antibiotics
etw01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:etw00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ECSP_5166 (acs)
   00620 Pyruvate metabolism
    ECSP_5166 (acs)
   00640 Propanoate metabolism
    ECSP_5166 (acs)
  Energy metabolism
   00680 Methane metabolism
    ECSP_5166 (acs)
Enzymes [BR:etw01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     ECSP_5166 (acs)
Lipid biosynthesis proteins [BR:etw01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   ECSP_5166 (acs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ACT74850
Position
complement(5169823..5171781)
Genome map
AA seq 652 aa AA seqDB search
MSQIHKHTIPANIADRCLINPQQYEAMYQQSINAPDTFWGEQGKILDWIKPYQKVKNTSF
APGNVSIKWYEDGTLNLAANCLDRHLQENGDRTAIIWEGDDASQSKHISYKELHRDVCRF
ANTLLKLGIKKGDVVAIYMPMVPEAAVAMLACARIGAVHSVIFGGFSPEAVAGRIIDSNS
RLVITSDEGVRAGRSIPLKKNVDDALKNPNVTSVEHVVVLKRTGGKIDWQEGRDLWWHDQ
VEQASDQHQAEEMNAEDPLFILYTSGSTGKPKGVLHTTGGYLVYAALTFKYVFDYHPGDI
YWCTADVGWVTGHSYLLYGPLACGATTLMFEGVPNWPTPARMAQVVDKHQVNILYTAPTA
IRALMAEGDKAIEGTDRSSLRILGSVGEPINPEAWEWYWKKIGNEKCPVVDTWWQTETGG
FMITPLPGATELKAGSATRPFFGVQPALVDNEGNPLEGATEGSLVITDSWPGQARTLFGD
HERFEQTYFSTFKNMYFSGDGARRDEDSYYWITGRVDDVLNVSGHRLGTAEIESALVAHP
KIAEAAVVGIPHNIKGQAIYAYVTLNHGEEPSPELYAEVRNWVRKEIGPLATPDVLHWTD
SLPKTRSGKIMRRILRKIAAGDTSNLGDTSTLADPGVVEKLLEEKQAIAMPS
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaaattcacaaacacaccattcctgccaacatcgcagaccgttgcctgataaac
cctcagcagtacgaggcgatgtatcaacaatctattaacgcacctgataccttctggggc
gaacagggaaaaattctcgactggatcaaaccgtaccagaaggtgaaaaacacctccttt
gcccccggtaatgtgtccattaaatggtacgaggacggcacgctgaatctggcggcaaac
tgccttgaccgccatctgcaagaaaacggcgatcgtaccgccatcatctgggaaggcgac
gacgccagccagagcaaacatatcagctataaagagctgcaccgcgacgtctgccgcttc
gccaataccctgctcaagctgggcattaaaaaaggtgatgtggtggcgatttatatgccg
atggtgccggaagccgcggttgcgatgctggcctgcgcccgtattggcgcggtgcattcg
gtaattttcggtggcttctcgccggaagcggttgccgggcgcattatcgattccaactca
cgactggtgatcacttccgacgaaggcgtgcgcgccgggcgtagtattccgctgaagaaa
aacgttgatgacgcactaaaaaacccgaacgtcaccagcgtagagcatgtggtggtactg
aagcgtactggcgggaaaattgactggcaggaagggcgcgacctgtggtggcacgaccag
gttgagcaagccagcgatcagcaccaggcggaagagatgaacgccgaagatccgctgttt
attctctatacctccggttctaccggaaaaccaaaaggcgtactgcacactaccggcggt
tatctggtgtacgcggcgctgacctttaaatatgtctttgattatcatccgggcgatatc
tactggtgcaccgccgatgtgggctgggtgaccggacacagttatttgctgtacggcccg
ctggcctgcggcgcgaccacgctgatgtttgaaggcgtaccgaactggccgacgcctgcc
cgtatggcacaggtggtggacaagcatcaggtcaatattctctataccgcgcccacggcg
attcgcgcgctgatggcggaaggcgataaagcgatcgaaggcaccgaccgttcgtcgctg
cgcattctcggttccgtgggcgagccaattaacccggaagcgtgggagtggtactggaaa
aaaatcggcaacgagaaatgtccggtggtcgatacctggtggcagaccgaaaccggcggt
ttcatgatcaccccgctgcctggcgctaccgagctgaaagccggttcggcaacacgtccg
ttcttcggcgtgcaaccggcgctggtcgataacgaaggtaacccgctggaaggggctacc
gaaggtagcctggtgatcaccgactcctggccgggtcaggcgcgtacgctgtttggcgat
cacgaacgttttgagcagacctatttttccaccttcaaaaatatgtatttcagcggcgac
ggcgcgcgtcgtgatgaagatagctattactggatcaccgggcgtgtggacgatgtgctg
aacgtctccggtcaccgtctgggaacggcggagattgagtcggcgctggtggcgcatccg
aaaatcgccgaagccgctgtcgtcggtattccgcacaatattaaaggtcaggcgatctac
gcctacgtcacgcttaatcacggggaggaaccgtcaccagaactgtacgcagaagtccgc
aactgggtgcgtaaagagattggcccgctggcgacgccagacgtgctgcactggaccgac
tccctgcctaaaacccgctccggcaaaattatgcgccgtattctgcgcaaaattgcggcg
ggcgataccagcaacctgggcgatacctcgacgcttgccgatcctggcgtagtcgagaag
ctgcttgaagagaagcaggctatcgcgatgccatcgtaa

DBGET integrated database retrieval system