KEGG   Eubacterium cylindroides: EC1_00370Help
Entry
EC1_00370         CDS       T02586                                 

Definition
formamidopyrimidine-DNA glycosylase (fpg) (EC:3.2.2.23 4.2.99.18)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
euc  Eubacterium cylindroides
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:euc03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(22981..23811)
Genome map
AA seq 276 aa AA seqDB search
MPEAPEVQTVLSTLEHQIKGAKILDVKVYYPKLIQNLDVTEFVSSLKNQRFCDFFRIGKY
LGFVMDDLDLIVHLRMEGKFYILKELPSDLKHIHCVTYLDDGRLLCYHDTRKFGRMALYP
KAVDVRRLDCFKNVGYDCLDENLDGMTFYKIIHPLKRNIKSALLDQSIIAGVGNIYADEI
LFSCKLDPRSRCQKISKKDCENIIYHTKRIIRGAMKAGGTTIRSYTSSLGVTGLFQLELK
VHSKKDEPCPVCKNKIKKIVVSQRGTYLCSNCQKRK
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgccagaagcaccagaagtacagacagtattgtcaacacttgaacatcagattaaaggc
gcaaagatcttagatgttaaagtgtattatccaaaactaattcaaaatttagatgtcaca
gaatttgtgtcttcattaaaaaatcaaagattttgtgacttctttcgcattggaaaatat
ttaggttttgtcatggatgatctagatttgattgttcatcttcgcatggaaggaaagttt
tatatcttaaaagaattgccgagcgatcttaaacacattcattgtgtcacgtatttggat
gatggaagattgttatgttatcatgatacaagaaaatttggtcgcatggctttgtatcct
aaagcggtggatgttaggcgactggattgttttaaaaatgtgggatatgactgtctggat
gaaaaccttgatggaatgacattttataagataattcatccgctaaaaagaaatattaaa
tcagctttactggatcaatccatcatagctggtgttggaaatatttatgccgatgaaatc
ttattttcttgtaaactagatccaagaagtcgttgccaaaagatatcaaaaaaagattgt
gaaaatatcatttatcatacaaaacgcatcatacgtggggctatgaaagcaggaggcacg
acgattcgttcgtatacttccagtttaggggtgactggtctttttcaattggaattaaaa
gttcattcaaaaaaagatgagccttgtcctgtttgtaaaaataagatcaaaaagatcgta
gtcagtcaaaggggtacttatctatgttcaaattgccaaaaaagaaaataa

DBGET integrated database retrieval system