KEGG   Eubacterium cylindroides: EC1_14220Help
Entry
EC1_14220         CDS       T02586                                 

Definition
Histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
euc  Eubacterium cylindroides
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:euc01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:euc00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1316134..1316412)
Genome map
AA seq 92 aa AA seqDB search
MLKRIDKNNKEQLQSYLQSRSQEIESDILIKVSEIINEVRMKKDEALKKYTYQFDKIKVD
TFKVTEEEIDEAIKQCDPAFMDAMKQAKENIT
NT seq 279 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaaaggatcgataaaaataataaggagcagctgcagtcttatctgcagagtcga
agtcaggaaattgaaagtgatattttgatcaaagtgtctgaaatcataaatgaagtaaga
atgaaaaaagatgaagctttaaaaaaatacacgtatcaatttgataaaataaaggtagat
acatttaaagttacagaagaagaaattgatgaagcgataaaacaatgtgatcctgcattt
atggatgccatgaagcaggcaaaagaaaatattacataa

DBGET integrated database retrieval system