KEGG   Escherichia coli O17 K52 H18 UMN026 (ExPEC): ECUMN_0139Help
Entry
ECUMN_0139        CDS       T00831                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihyropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
eum  Escherichia coli O17:K52:H18 UMN026 (ExPEC)
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:eum00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    ECUMN_0139 (folK)
Enzymes [BR:eum01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     ECUMN_0139 (folK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(161238..161717)
Genome map
AA seq 159 aa AA seqDB search
MTVAYIAIGSNLASPLEQVNAALKALGDIPESHILAVSSFYRTPPLGPQDQPDYLNAAVA
LETSLAPEELLNHTQRIELQQGRVRKAERWGPRTLDLDIMLFGNEVINTERLTVPHYDMK
NRGFMLWPLFEIAPELVFPDGTVLGNLLKINKFHELNKW
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgacagtggcgtatattgccataggcagcaatctggcctctccgctggagcaggtcaat
gctgccctgaaagcattaggcgatatccctgaaagccacattcttgccgtttcttcgttt
taccgcactccaccgctggggccgcaagatcaacccgattacttaaacgcagccgtggcg
ctggaaacctctcttgcacctgaagagttactcaaccacacacaacgtattgagttacaa
caaggtcgcgtccgtaaagcggaacgctgggggccgcgcacactggatctcgacatcatg
ctatttggtaatgaagtaataaataccgaacgcctgaccgttccgcactacgatatgaag
aatcgtggatttatgctgtggccgctgtttgaaattgcgccggagctggtgtttcctgat
ggaacagtattaggaaatttattaaaaataaataaatttcatgaattaaacaaatggtga

DBGET integrated database retrieval system