KEGG   Escherichia coli O17 K52 H18 UMN026 (ExPEC): ECUMN_0387Help
Entry
ECUMN_0387        CDS       T00831                                 

Gene name
lacZ
Definition
beta-D-galactosidase (EC:3.2.1.23)
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
eum  Escherichia coli O17:K52:H18 UMN026 (ExPEC)
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:eum00052]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:eum00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:eum00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(421593..424667)
Genome map
AA seq 1024 aa AA seqDB search
MTMITDSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR
FAWFPAPEAVPESWLECDLPDADTIVVPSNWQMHGYDAPIYTNVTYPITVNPPFVPVENP
TGCYSLTFNVDESWLQEGQTRIIFDGVNSAFHLWCNGRWVGYGQDSRLPSEFDLSAFLRA
GENRLAVMVLRWSDGSYLEDQDMWRMSGIFRDVSLLHKPTTQISDFHVATRFNDDFSRAV
LEAEVQMCGELRDELRVTVSLWQGETQVASGTTPFGGEIIDERGGYADRVTLRLNVENPA
LWSAEIPNLYRAVVKLHTADGTLIEAEACDVGFREVRIENGLLLLNGKPLLIRGVNRHEH
HPLHGQVMDEQTMVQDILLMKQNNFNAVRCSHYPNHPLWYTLCDRYGLYVVDEANIETHG
MVPMNRLTDDPRWLPAMSERVTRMVQRDRNHPSVIIWSLGNESGHGANHDALYRWIKSVD
PSRPVQYEGGGADTSATDIICPMYARVDEDQPFPAVPKWSIKKWLSLPGELRPLILCEYA
HAMGNSLGGFAKYWQAFRQYPRLQGGFVWDWVDQSLIKYDENGNPWSAYGGDFGDTPNDR
QFCMNGLVFADRTPHPALTEAKHQQQFFQFRLSGRTIEVTSEYLFRHSDNELLHWTVALD
GKPLASGEVPLDVAPQGKQVIELPVLPQPESTGQLWLTVHVVQPNATAWSEAGHISAWHQ
WRLAENLSVTLPAASHSIPHLTTSEMDFCIELGNKRWQFNRQSGFLSQMWIGDEKQLLTP
LRAQFTRAPLDNDIGVSEATRIDPNAWVERWKAAGHYQAEAALLQCTADTLADAVLITTA
HAWQHQGKTLFISRKTYRIDGSGQMAITVDVEVASDTPHPARIGLTCQLAQVAERVNWLG
LGPQENYPDRLTAACFDRWDLPLSDMYTPYVFPSENGLRCGTRELNYGPHQWRGDFQFNI
SRYSQQQLMETSHRHLLHAEEGTWLNIDGFHMGIGGDDSWSPSVSAEFQLSAGRYHYQLV
WCQK
NT seq 3075 nt NT seq  +upstreamnt  +downstreamnt
atgactatgattacggattcactggccgtcgtattacaacgtcgtgactgggaaaaccct
ggcgttacccaacttaatcgccttgcggcacatccccctttcgccagctggcgtaatagc
gaagaggcccgcaccgatcgcccttcccaacagttgcgcagcctgaatggcgaatggcgc
tttgcctggtttccggcaccagaagcggtgccggaaagctggctggagtgcgatcttcct
gacgccgatactatcgtcgtcccctcaaactggcagatgcacggttacgacgcgcccatc
tacaccaacgtgacctatcccattacggtcaatccgccgtttgttcccgtggagaatccg
acaggttgttactcgctcacatttaatgttgatgaaagctggctacaggaaggccagacg
cgaattatttttgatggcgttaattcggcgtttcatttgtggtgcaacgggcgctgggtc
ggttacggccaggacagccgtttgccgtctgaatttgacctgagcgcatttttacgcgcc
ggagaaaaccgcctcgcggtgatggtactgcgctggagtgacggcagttatctggaagat
caggatatgtggcggatgagcggcattttccgtgacgtctcgttgctgcacaaaccgacc
acacaaatcagcgatttccatgttgccactcgctttaatgatgatttcagccgcgcggta
ctggaggcagaagttcagatgtgcggcgaactgcgcgatgagctgcgggtgacggtttct
ttgtggcagggtgaaacgcaggtcgccagcggcaccacgcctttcggcggtgaaattatc
gatgagcgtggtggttatgccgatcgcgtcacgctacgtctgaacgtcgaaaacccggcg
ctgtggagcgccgaaatcccgaatctctatcgtgcggtggttaaactgcacaccgccgac
ggcacgctgattgaagcagaagcctgcgatgtcggtttccgcgaagtgcggattgaaaat
ggtctgctgctgctgaacggcaagccgttgctgattcgcggcgttaaccgtcacgagcat
catcctctgcatggtcaggtcatggatgagcagacgatggtgcaggatatcctgctgatg
aagcagaacaactttaacgccgtgcgctgttcgcattatccgaatcatccgctgtggtac
acgttgtgcgaccgctacggcctgtatgtggtggatgaagccaatattgaaacccacggc
atggtgccaatgaatcgtctgaccgatgatccgcgctggctacccgcgatgagcgaacgc
gtaacgcgaatggtgcagcgcgatcgtaatcacccgagtgtgatcatctggtcgctgggg
aatgaatcaggccacggcgctaatcacgacgcactgtatcgctggatcaaatctgtcgat
ccttcccgcccggtgcagtatgaaggcggcggagccgacacctccgcaactgatattatt
tgcccgatgtacgcgcgcgtggatgaagaccagcccttcccggctgtgccgaaatggtcc
atcaaaaaatggctttcgctgcctggagaactgcgcccgctgatcctttgcgaatatgcc
cacgcaatgggtaacagtcttggcggcttcgctaaatactggcaggcatttcgtcagtac
ccccgtttacagggcggcttcgtctgggactgggtggatcagtcgctgattaaatatgat
gaaaacggcaacccgtggtcggcttacggcggtgattttggcgatacgccgaacgatcgc
cagttctgcatgaacggtctggtctttgccgaccgcacgccgcatccggcgctgacggaa
gcaaaacaccagcagcagtttttccagttccgtttatccgggcgaaccatcgaagtgacc
agcgaatacctgttccgtcatagcgataacgagctcctgcactggacggtggcactggat
ggcaagccgctggcaagcggtgaagtgcctctggatgtcgctccacaaggtaaacaggta
attgaactgcctgtactaccgcagccggaaagcaccgggcaactctggctaacggtacac
gtagtgcaaccgaacgcgaccgcatggtcagaagccggacacatcagcgcctggcatcag
tggcgtctggcggaaaacctcagcgtgacactccccgccgcgtcccactccatcccgcat
ctgaccaccagcgaaatggatttttgcatcgagctgggtaataagcgttggcaatttaac
cgccagtcaggctttctttcacagatgtggattggcgatgaaaaacaactgctgacgccg
ctgcgcgctcagttcacccgtgcaccgctggataacgacattggcgtaagtgaagcgacc
cgcattgaccctaacgcctgggtcgaacgctggaaggcggcgggccattaccaggccgaa
gcagcgttgttgcagtgcacggcagatacacttgccgacgcggtgctgattacgaccgct
cacgcgtggcagcatcaggggaaaaccttatttatcagccggaaaacctaccggattgat
ggtagtggtcaaatggcgattaccgttgatgttgaagtagcgagcgatacaccgcatccg
gcacggattggcctgacctgccagctggcgcaggtcgcagagcgggtaaactggctcgga
ttagggccgcaagaaaactatcccgaccgccttactgcggcctgttttgaccgctgggat
ctgccattgtcagacatgtataccccgtacgtcttcccgagcgaaaacggtctgcgctgc
gggacgcgcgaattgaattatggcccacaccagtggcgcggcgacttccagttcaatatc
agtcgctacagccaacaacaactgatggaaaccagccatcgccatctgctgcacgcggaa
gaaggcacatggctgaatatcgacggtttccatatggggattggtggcgacgactcctgg
agcccgtcagtgtcggcggaattccagctgagcgccggtcgctaccattaccagttggtc
tggtgtcaaaaataa

DBGET integrated database retrieval system