KEGG   Escherichia coli O17 K52 H18 UMN026 (ExPEC): ECUMN_0421Help
Entry
ECUMN_0421        CDS       T00831                                 

Gene name
phoA
Definition
alkaline phosphatase (EC:3.1.3.1)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
eum  Escherichia coli O17:K52:H18 UMN026 (ExPEC)
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:eum00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:eum00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:eum02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
457110..458525
Genome map
AA seq 471 aa AA seqDB search
MKQSTIALALLPLLFSPVTKARTPEMPVLENRAAQGDITAPGGARRLTGDQTAALRDSLS
DKPAKNIILLIGDGMGDSEITAARNYAEGAGGFFKGIDALPLTGQYTHYALNKKTGKPDY
VTDSAASATAWSTGVKTYNGALGVDIHEKDHPTILEMAKAAGLATGNVSTAELQDATPAA
LVAHVTSRKCYGPSATSEKCPGNALEKGGKGSITEQLLNARADVTLGGGAKTFAETATVG
EWQGKTLREQAQARGYQLVSDAASLNAVTEANQQKPLLGLFADGNMPVRWLGPKATYHGN
IDKPAVTCTPNPQRNDSVPTLAQMTDKAIELLSKNEKGFFLQVEGASIDKQDHAANPCGQ
IGETVDLDEAVQRALEFAKKDGNTLVIVTADHAHASQIVAPDTKAPGLTQALNTKDGAVM
VMSYGNSEEDSQEHTGSQLRIAAYGPHAANVVGLTDQTDLFYTMKAALGLK
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacaaagcactattgcactggcactcttaccgttactgttttcccctgtgacaaaa
gcccggacaccagaaatgcctgttctggaaaaccgggctgctcagggcgatattactgca
cccggcggtgctcgccgcttaacgggtgatcagaccgctgctctgcgtgattctcttagc
gataaacctgcaaaaaatattattttgctgattggcgatgggatgggggactcggaaatt
actgctgcacgcaattatgccgaaggtgcgggcggcttttttaaaggtatcgatgcctta
ccgcttaccggacaatacacacactatgcgctgaataaaaaaaccggcaaaccggactac
gttaccgactcggctgcatcagcaaccgcctggtcaaccggtgtcaaaacctataacggt
gcgctgggcgtcgatattcacgaaaaagatcacccaacgattctggaaatggcaaaagcc
gcaggtctggcgaccggtaacgtttctaccgcagagttgcaggatgccacgcccgccgcg
ctggtggcgcatgtgacctcgcgcaaatgctacggtccgagcgcgaccagtgaaaaatgt
ccgggtaacgctctggaaaaaggcgggaaaggatcgattaccgaacagctgcttaacgct
cgtgccgatgttacgcttggcggcggcgcaaaaacctttgctgaaacggcaaccgtcggc
gaatggcagggaaaaacgctgcgtgaacaggcacaggcgcgtggttatcagttggtgagt
gatgctgcctcgctaaatgcggtgacggaagcgaaccagcaaaaacccctgctaggactg
tttgctgacggcaatatgccagtgcgctggctaggaccgaaagcaacgtaccacggcaat
atcgacaagcccgcagttacctgtacgcctaatccgcaacgtaatgacagcgtaccgacc
ctggcgcagatgaccgacaaagccattgaattgttgagtaaaaatgagaaaggttttttc
ctgcaagttgaaggtgcatcaatcgataaacaggatcacgctgcgaatccttgtgggcaa
attggcgagacggtcgatctcgatgaagccgtacaacgtgcgctggaattcgctaaaaag
gatggcaacacgctggtcatagtcaccgctgatcacgcccacgccagccagattgttgcg
ccggacaccaaagcgccgggcctcacccaggcgctaaataccaaagatggcgcagtgatg
gtgatgagttacgggaactctgaagaggattcacaagaacataccggtagtcagctgcgt
attgctgcgtatggcccacatgccgccaatgtcgttggactgaccgaccagaccgatctc
ttctacaccatgaaagccgccctggggctgaaataa

DBGET integrated database retrieval system