KEGG   Escherichia coli O17 K52 H18 UMN026 (ExPEC): ECUMN_0524Help
Entry
ECUMN_0524        CDS       T00831                                 

Gene name
ybaS
Definition
(RefSeq) amidase
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
eum  Escherichia coli O17:K52:H18 UMN026 (ExPEC)
Pathway
eum00220  Arginine biosynthesis
eum00250  Alanine, aspartate and glutamate metabolism
eum00471  D-Glutamine and D-glutamate metabolism
eum01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eum00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ECUMN_0524 (ybaS)
   00220 Arginine biosynthesis
    ECUMN_0524 (ybaS)
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    ECUMN_0524 (ybaS)
Enzymes [BR:eum01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     ECUMN_0524 (ybaS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase
Motif
Other DBs
NCBI-GeneID: 7155998
NCBI-ProteinID: YP_002411287
UniProt: B7N938
Structure
PDB: 

Jmol
Position
569458..570390
Genome map
AA seq 310 aa AA seqDB search
MLDANKLQQAVDQAYTQFHSLNGGQNADYIPFLANVPGQLAAVAIVTCDGNIYRAGDSDY
RFALESISKVCTLALALEDVGPQAVQDKVGADPTGLPFNSVIALELHGGKPLSPLVNAGA
IATTSLINAENAEQRWQRILHIQQQLAGEQVALSDEVNQSEQTTNFHNRAIAWLLYSAGY
LYCDAMEACDVYTRQCSTLINTVELATLGATLAAGGVNPLTHKRVLQADNVPYILAEMMM
EGLYGRSGDWAYRVGLPGKSGVGGGILAVVPGVMGIAAFSPPLDEEGNSVRGQKMVASVA
KQLGYNVFKG
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgttagatgcaaacaaattacagcaggcagtggatcaggcttacacccaatttcactca
cttaacggcggacaaaatgccgactacattccctttctggcgaatgtacctggtcaactg
gcagcagtggctattgtgacctgcgatggcaacatctatcgcgcgggtgatagtgattac
cgctttgcgctggaatccatctcgaaagtctgtacgttagcccttgcgttagaagatgtc
ggcccgcaggcggtacaggacaaagttggcgctgacccgaccggattgccctttaactca
gttatcgccttagagttgcatggcggcaaaccgctgtcgccactggtaaatgctggcgct
attgccaccaccagcctgattaacgctgaaaatgccgaacaacgctggcagcgaatttta
catatccaacaacaactggctggtgagcaggtagcgctctctgacgaagtaaaccagtcg
gaacaaacaaccaacttccataaccgggccattgcctggctgctgtactccgccggatat
ctctattgtgatgcaatggaagcctgtgacgtgtacacccgtcagtgctccacgctcatc
aatactgttgaactggcaacgcttggcgcgacgctggcggcgggtggtgtgaatccgctg
acgcataaacgcgttcttcaggccgacaacgtgccgtacattctggctgaaatgatgatg
gaagggctgtatggtcgctccggtgactgggcgtatcgcgttggtttaccgggcaaaagc
ggtgtaggtggcggtattctggcggtcgtccctggcgtgatgggaattgccgcgttctca
ccaccgctggacgaagaaggcaacagtgttcgcggtcaaaaaatggtggcatcggtcgct
aagcaactcggctataacgtgtttaagggctga

DBGET integrated database retrieval system