KEGG   Escherichia coli O17 K52 H18 UMN026 (ExPEC): ECUMN_0857Help
Entry
ECUMN_0857        CDS       T00831                                 

Gene name
ybhC
Definition
(RefSeq) pectin methylesterase
  KO
K01051  pectinesterase [EC:3.1.1.11]
Organism
eum  Escherichia coli O17:K52:H18 UMN026 (ExPEC)
Pathway
eum00040  Pentose and glucuronate interconversions
eum01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eum00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    ECUMN_0857 (ybhC)
Enzymes [BR:eum01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     ECUMN_0857 (ybhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pectinesterase
Motif
Other DBs
NCBI-GeneID: 7158441
NCBI-ProteinID: YP_002411612
UniProt: B7NA15
Structure
PDB: 

Jmol
Position
complement(913517..914800)
Genome map
AA seq 427 aa AA seqDB search
MNTFSVSRLALALAFGVTLTACSSTPPDQRPSDQTAPGTSSRPILSAKEAQNFDAQHYFA
SLTPGAAAWNPSPITLPAQPDFVVGPAGTQGVTHTTIQAAVDAAIIKRTNKRQYIAVMPG
EYQGTVYVPAAPGGITLYGTGEKPIDVKIGLSLDGGMSPADWRHDVNPRGKYMPGKPAWY
MYDSCQSKRSDSIGVLCSAVFWSQNNGLQLQNLTIENTLGDSVDAGNHPAVALRTDGDKV
QINNVNILGRQNTFFVTNSGVQNRLETNRQPRTLVTNSYIEGDVDIVSGRGAVVFDNTEF
RVVNSRTQQEAYVFAPATLSNIYYGFLAVNSRFNASGDGVAQLGRSLDVDANTNGQVVIR
DSAINEGFNTAKPWADAVISNRPFAGNTGSVDDNDEIQRNLNDTNYNRMWEYNNRGVGSK
VVAEAKK
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
gtgaacacattttcagtttcccgtctggcgctggcattggcttttggcgtgacgctgacc
gcctgtagctcaacaccgcccgatcaacgtccttctgatcaaaccgcgcctggtacctct
tctcgcccgattctgtcggcaaaagaagcgcagaatttcgatgctcaacactattttgca
tccctgacaccaggtgcggcagcgtggaatccttccccgattaccctgcctgcgcaacct
gactttgttgtcggcccggcgggtactcaaggtgtaacgcataccacgattcaggcggcg
gtagatgcggcaattatcaagcgcaccaacaagcgccagtatattgccgtgatgcctggt
gagtatcagggaacggtgtatgtccctgccgctccgggtggaattactctgtacggtaca
ggtgaaaaaccgattgatgtgaagattgggctttcccttgatgggggcatgagccctgcc
gactggcgtcacgacgtcaacccgcgcggcaaatatatgccaggtaaaccagcgtggtat
atgtacgatagctgccagagcaaacgcagcgacagtatcggtgttctctgctctgcggtc
ttctggtcacaaaacaatggcctgcaactgcaaaatctgaccatcgaaaacacgctgggc
gatagcgtagatgcgggtaaccatccggcggtggcactgcgtactgatggtgacaaagtg
cagatcaataacgtcaacattctcggtcgtcagaataccttctttgtcaccaacagtggt
gtgcaaaaccgtctggaaaccaaccgtcagccgcgtactctggtgaccaacagttacatt
gaaggggatgtggatatcgtttctggtcgcggcgcagtggtgttcgataacaccgaattc
cgcgtggtgaactcacgtactcagcaagaagcgtatgtgtttgcaccggctacgctgtct
aacatctattacggtttcctcgccgtaaacagccgtttcaatgcttccggtgatggcgtg
gcgcaactgggtcgctcgctggatgttgatgccaataccaacggtcaggtggtgatccgt
gatagcgccatcaacgaaggttttaacacagccaaaccctgggctgatgcggtgatctct
aatcgtccgtttgcgggtaacaccggcagcgttgatgataacgacgaaatacaacgcaat
ctgaatgacactaactacaaccgcatgtgggaatacaataaccgcggcgtgggtagcaaa
gtggttgcagaggcgaagaagtaa

DBGET integrated database retrieval system