KEGG   Escherichia coli O17 K52 H18 UMN026 (ExPEC): ECUMN_1335Help
Entry
ECUMN_1335        CDS       T00831                                 

Gene name
ydfQ
Definition
putative membrane-associated lysozyme; Qin prophage
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
eum  Escherichia coli O17:K52:H18 UMN026 (ExPEC)
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1370195..1370728
Genome map
AA seq 177 aa AA seqDB search
MNTKIKYGLSAAVLALIAAGAPAPDILDQFLDEKEGNHTTAYRDGAGIWTICRGAIMVDG
KPVVPGMKLSKEKCDQVNAIERDKALAWVEKNIRVPLTEPQKAGIASFCPYNIGPGKCFP
STFYRRINAGDRKGACEAIRWWIKDGGRDCRIRSNNCYGQVSRRDQESALACWGIDR
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgaacaccaaaatcaaatacggcctgtcggctgccgttctggcgctgattgccgctggt
gcgcctgcgcctgacattctcgaccagtttctggatgaaaaggaaggcaaccacaccacg
gcataccgtgatggtgcaggtatctggaccatctgccgtggtgccatcatggtggatggc
aaacctgtcgttccgggcatgaagttgtcgaaggaaaaatgcgaccaggttaacgccatt
gagcgtgataaagcgctggcgtgggtggagaaaaacatcagagtgccgctgaccgaaccc
cagaaagcggggatcgcgtcattctgtccgtacaacattggtcccggtaagtgtttcccg
tcgacgttttacagacgaattaatgctggtgatcgaaaaggtgcctgcgaagcgattcgc
tggtggattaaggacggtggcagagactgccgtattcgttcaaacaactgttacggtcag
gtatcccgtcgtgaccaggagagcgcgctggcgtgctggggtatcgacagataa

DBGET integrated database retrieval system