KEGG   Escherichia coli O17 K52 H18 UMN026 (ExPEC): ECUMN_1560Help
Entry
ECUMN_1560        CDS       T00831                                 

Gene name
trpB
Definition
(RefSeq) tryptophan synthase subunit beta (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
eum  Escherichia coli O17:K52:H18 UMN026 (ExPEC)
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:eum00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ECUMN_1560 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ECUMN_1560 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ECUMN_1560 (trpB)
Enzymes [BR:eum01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     ECUMN_1560 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(1569055..1570248)
Genome map
AA seq 397 aa AA seqDB search
MTTLLNPYFGEFGGMYVPQILMPALRQLEEAFVSAQKDPEFQAQFNDLLKNYAGRPTALT
KCQNITAGTNTTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKTEIIAETGAGQHGVASA
LASALLGLKCRIYMGAKDVERQSPNVFRMHLMGAEVIPVHSGSATLKDACNEALRDWSGS
YETAHYMLGTAAGPHPYPTIVREFQRMIGEETKAQILEREGRLPDAVIACVGGGSNAIGM
FADFINETDVGLIGVEPGGHGIETGEHGAPLKHGRVGIYFGMKAPMMQTEDGQIEESYSI
SAGLDFPSVGPQHAYLNSTGRADYVSITDDEALEAFKTLCLHEGIIPALESSHALAHALK
MMRENPEKEQLLVVNLSGRGDKDIFTVHDILKARGEI
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgacaacattacttaacccctattttggtgagtttggcggcatgtacgtgccacaaatc
ctgatgcctgctctgcgccagctggaagaagcttttgtcagcgcgcaaaaagatcctgaa
tttcaggcccagttcaacgacctgctgaaaaactatgccgggcgtccaaccgcactcacc
aaatgccagaacatcacggctggcactaacaccacgctgtatctcaagcgcgaagatttg
ctgcacggcggcgcgcataaaactaaccaggtgctcggtcaggctttactggcgaagcgg
atgggtaaaaccgaaatcatcgccgaaaccggtgccggtcagcatggcgtggcgtcggcc
cttgccagcgccctgctcggcctgaaatgccgtatttatatgggtgccaaagacgttgaa
cgccagtcgcctaacgtttttcgtatgcatttaatgggcgcggaagtgatcccggtgcat
agcggttccgcgacgctgaaagatgcctgtaatgaggcgctgcgcgactggtccggcagt
tatgaaaccgcgcactatatgctgggcaccgcagctggcccacatccttatccgaccatt
gtccgtgagttccagcggatgattggcgaagaaaccaaagcacagattctggaaagagaa
ggtcgcctgccggatgcggttatcgcttgtgttggcggcggttcaaatgccatcggcatg
tttgctgattttatcaacgaaaccgacgtcggcctgattggtgtcgaaccaggcggtcac
ggtatcgaaactggcgagcacggcgcaccgttaaaacacggtcgcgtgggcatctatttc
ggtatgaaagcgccgatgatgcaaaccgaagacggacagattgaagaatcttactccatc
tccgccggactggatttcccgtctgtcggcccacaacacgcgtatcttaacagcactgga
cgcgctgattacgtgtcaattaccgatgatgaagcactggaagccttcaaaacgctgtgc
ctgcacgaagggatcatcccggcgctggagtcctcccacgccctggcccatgcgctgaaa
atgatgcgcgaaaacccggaaaaagagcagctactggtggttaacctttccggtcgcggc
gataaagacatcttcaccgttcacgatattttgaaagcacgaggggaaatctga

DBGET integrated database retrieval system