KEGG   Escherichia coli O17 K52 H18 UMN026 (ExPEC): ECUMN_1733Help
Entry
ECUMN_1733        CDS       T00831                                 

Gene name
adhP
Definition
(RefSeq) alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
eum  Escherichia coli O17:K52:H18 UMN026 (ExPEC)
Pathway
eum00010  Glycolysis / Gluconeogenesis
eum00071  Fatty acid degradation
eum00350  Tyrosine metabolism
eum00625  Chloroalkane and chloroalkene degradation
eum00626  Naphthalene degradation
eum01100  Metabolic pathways
eum01110  Biosynthesis of secondary metabolites
eum01120  Microbial metabolism in diverse environments
eum01130  Biosynthesis of antibiotics
eum01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:eum00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ECUMN_1733 (adhP)
  Lipid metabolism
   00071 Fatty acid degradation
    ECUMN_1733 (adhP)
  Amino acid metabolism
   00350 Tyrosine metabolism
    ECUMN_1733 (adhP)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    ECUMN_1733 (adhP)
   00626 Naphthalene degradation
    ECUMN_1733 (adhP)
Enzymes [BR:eum01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     ECUMN_1733 (adhP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 CoA_binding Methyltransf_25 2-Hacid_dh_C Methyltransf_31 Phage_holin_2_1
Motif
Other DBs
NCBI-GeneID: 7155003
NCBI-ProteinID: YP_002412469
UniProt: B7N4P1
Structure
PDB: 

Jmol
Position
complement(1750784..1751794)
Genome map
AA seq 336 aa AA seqDB search
MKAAVVTKDHHVDVTDKTLRSLKHGEALLKMECCGVCHTDLHVKNGDFGDKTGVILGHEG
IGVVAEVGPGVTSLKPGDRASVAWFYEGCGHCEYCNSGNETLCRSVKNAGYSVDGGMAEE
CIVVADYAVKVPDGLDSAAASSITCAGVTTYKAVKLSKIRPGQWIAIYGLGGLGNLALQY
AKNVFNAKVIAIDVNDEQLKLATEMGADLAINSRTEDAAKIVQEKTGGAHAAVVTAVAKA
AFNSAVDAVRAGGRVVAVGLPPESMSLDIPRLVLDGIEVVGSLVGTRQDLTEAFQFAAEG
KVVPKVALRPLADINTIFTEMEEGKIRGRMVIDFRR
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctgcagttgttacgaaggatcatcatgttgacgttacggataaaacactgcgc
tcactgaaacatggcgaagccctgctgaaaatggagtgttgtggtgtatgtcacaccgat
cttcatgttaagaatggcgattttggtgacaaaaccggcgtaattctgggccatgaaggc
atcggtgtggtggcagaagttggcccaggtgtcacctcattaaaaccaggcgatcgtgcc
agcgtggcgtggttttacgaaggatgcggtcattgcgaatactgtaacagtggtaacgaa
acgctctgccgttcagttaaaaatgccggatacagcgttgatggcgggatggcggaagag
tgcatcgtggtcgccgattacgcggtaaaagtgccagatggtctggactcggcggcggcc
agcagcattacctgtgcgggggtcaccacctacaaagccgttaagctgtcaaaaattcgt
ccagggcagtggattgctatctacggtcttggcggtctgggtaacctcgccctgcaatac
gcgaagaatgtctttaacgccaaagtgatcgccattgatgtcaatgatgagcagttgaaa
ctggcaaccgaaatgggtgcagatttagcgattaactcacgcaccgaagacgccgccaaa
attgtgcaggagaaaaccggtggtgcacacgctgcggtggtgacagcggtagctaaagct
gcgtttaactctgcggtcgatgccgttcgtgcaggcgggcgtgttgtggcagtcggtctg
ccgccggagtctatgagcctggatatcccacggctggtgctggatggtattgaagtggtc
ggttcgctggtcggcacgcgccaggatctcaccgaagccttccagtttgccgccgaaggc
aaagtggtgccgaaagtcgccctgcgtccgttagcggacatcaacaccatctttactgag
atggaagaaggcaaaatccgtggccgtatggtgattgatttccgccgctaa

DBGET integrated database retrieval system