KEGG   Escherichia coli O17 K52 H18 UMN026 (ExPEC): ECUMN_1841Help
Entry
ECUMN_1841        CDS       T00831                                 

Gene name
ydfQ
Definition
putative membrane-associated lysozyme; Qin prophage
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
eum  Escherichia coli O17:K52:H18 UMN026 (ExPEC)
Brite
Enzymes [BR:eum01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     ECUMN_1841 (ydfQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1869440..1869973)
Genome map
AA seq 177 aa AA seqDB search
MNTKIRYGLSAAVLALIGAGASAPQILDQFLDEKEGNHTMAYRDGSGIWTICRGATVVDG
KTVFPNMKLSKEKCDQVNAIERDKALAWVERNIKVPLTEPQKAGIASFCPYNIGPGKCFP
STFYKRLNAGDRKGACEAIRWWIKDGGRDCRIRSNNCYGQVIRRDQESALTCWGIEQ
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgaacacaaaaatcagatacggcctgtcggctgccgttctggcgctgattggtgctggc
gcatctgctcctcagatacttgaccagtttctggacgaaaaagaaggtaaccacacaatg
gcataccgcgatggttctggcatatggaccatctgtcggggtgccacagtggtggatgga
aaaaccgtttttcccaatatgaaactgtcgaaggaaaaatgcgaccaggtcaacgccatt
gagcgtgataaggcgctggcatgggtggagcgcaatattaaagtaccactgaccgaacca
caaaaagcgggtatcgcgtcattttgtccctataacattggccccggtaagtgtttcccg
tcgacgttttataagcggctgaatgctggtgatcgtaaaggtgcatgcgaagcgattcgc
tggtggattaaggatggcggacgcgattgccgcattcgttcaaataactgttacggtcag
gttattcgtcgtgaccaggagagcgcattaacctgctgggggatagaacagtga

DBGET integrated database retrieval system