KEGG   Escherichia coli O17 K52 H18 UMN026 (ExPEC): ECUMN_1894Help
Entry
ECUMN_1894        CDS       T00831                                 

Gene name
folM
Definition
short chain dehydrogenase (EC:1.5.1.3)
Orthology
K13938  
dihydromonapterin reductase / dihydrofolate reductase [EC:1.5.1.- 1.5.1.3]
Organism
eum  Escherichia coli O17:K52:H18 UMN026 (ExPEC)
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:eum00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    ECUMN_1894 (folM)
   00670 One carbon pool by folate
    ECUMN_1894 (folM)
Enzymes [BR:eum01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     ECUMN_1894 (folM)
    1.5.1.-  
     ECUMN_1894 (folM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1915934..1916656
Genome map
AA seq 240 aa AA seqDB search
MGKTQPLPILITGGGRRIGLALAWHFINQKQPVIVSYRTHYPAIDGLIKAGAQCIQADFS
TNDGVMAFADEVLKSTHGLRAILHNASAWMAEKPGAPLSDVLACMMQIHVNTPYLLNHAL
ERLLRGHGHASSDIIHFTDYVVERGSDKHIAYAASKAALDNMTRSFARKLAPEVKVNSIA
PSLILFNEHDDAEYRQQALNKSLMKTAPGEKEVIDLVDYLLTSCFVTGRSFPLDGGRHLR
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaaacccagcccttgccaatattaattactggcggaggtcgtcgcatcggcctc
gcactcgcctggcatttcattaatcaaaagcaaccggtgattgtcagctatcggacgcac
tatccagccattgatggactaattaaggcaggtgcgcagtgtattcaggctgatttttcg
accaacgacggtgtgatggcgtttgccgatgaagtactaaaaagtacccatggtctgcgt
gctattttgcataacgccagcgcgtggatggcggaaaaaccgggtgcgccactgtccgac
gtactggcttgcatgatgcagatccacgttaataccccatacctgctcaaccatgcgcta
gaaagattactgcgtgggcacggacacgcctccagcgatatcattcactttaccgattat
gtggtggagcgcggtagcgacaaacatattgcctatgctgcaagcaaagcggcactggat
aatatgactcgctcgtttgcccgcaagctggcaccggaagtgaaagtgaattctattgcg
ccatcgctgatcctgtttaatgaacatgatgatgccgaatatcgacaacaggcgctgaat
aaatcactgatgaaaaccgcgcctggcgagaaagaagtgatcgacctggtcgattactta
cttaccagctgctttgtcaccggacgcagtttccctcttgatggcggtcgtcatctgcgt
taa

DBGET integrated database retrieval system