KEGG   Escherichia coli O17 K52 H18 UMN026 (ExPEC): ECUMN_2012Help
Entry
ECUMN_2012        CDS       T00831                                 

Gene name
pfkB
Definition
6-phosphofructokinase 2 (EC:2.7.1.11)
Orthology
K16370  
6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
eum  Escherichia coli O17:K52:H18 UMN026 (ExPEC)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:eum00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ECUMN_2012 (pfkB)
   01230 Biosynthesis of amino acids
    ECUMN_2012 (pfkB)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ECUMN_2012 (pfkB)
   00030 Pentose phosphate pathway
    ECUMN_2012 (pfkB)
   00051 Fructose and mannose metabolism
    ECUMN_2012 (pfkB)
   00052 Galactose metabolism
    ECUMN_2012 (pfkB)
  Energy metabolism
   00680 Methane metabolism
    ECUMN_2012 (pfkB)
Enzymes [BR:eum01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     ECUMN_2012 (pfkB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2040999..2041928
Genome map
AA seq 309 aa AA seqDB search
MVRIYTLTLAPSLDSATITPQIYPEGKLRCTAPVFEPGGGGINVARAIAHLGGSATAIFP
AGGATGEHLVSLLADENVPVATVEAKDWTRQNLHVHVEASGEQYRFVMPGAALNEDEFRQ
LEEQVLEIESGAILVISGSLPPGVKLEKLTQLISAAQKQGIRCIVDSSGEALSAALAIGN
IELVKPNQKELSALVNRELTQPDDVRKAAQEIVNSGKAKRVVVSLGPQGALGVDSENCIQ
VVPPPVKSQSTVGAGDSMVGAMTLKLAENASLEEMVRFGVAAGSAATLNQGTRLCSQDDT
QKIYAYLSR
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atggtacgtatctatacgttgacacttgcgccctctctcgatagcgcaacaattaccccg
caaatttatcccgaaggaaagctgcgctgtaccgcaccagtattcgaacccggaggcggc
ggcatcaacgtcgcccgcgccattgcccatcttggaggcagtgccacagcgatcttcccg
gcgggtggtgcgaccggcgaacatctggtttcactgttggcagatgaaaatgtccccgtc
gctactgtagaagccaaagactggacccggcagaatttacacgtacatgtggaagcaagc
ggtgagcagtatcgttttgttatgccaggcgcggcattaaatgaagatgagtttcgccag
cttgaagagcaagttctggaaattgaatccggggccattctggtcataagcggaagcctg
ccgccaggtgtgaagctggaaaaattaacccaactgatttccgctgcgcaaaaacaaggg
attcgctgcatcgtcgacagttctggcgaagcgttaagtgcagcactggcgattggtaat
atcgagttggttaagcctaaccaaaaagaactcagtgcgctagtgaatcgcgaactcacc
cagccagacgatgtccgcaaagccgcgcaggaaatcgttaatagcggcaaggccaaacga
gttgtcgtttccctgggtccacaaggggcgctgggcgttgatagtgaaaactgcattcag
gttgtgccaccaccggtgaaaagccagagcaccgttggcgctggtgacagcatggtcggc
gcgatgacactgaaactggcagaaaatgcctctcttgaagagatggtccgttttggcgta
gctgcggggagtgcagccacactcaatcagggaacacgcctgtgctcccaagacgataca
caaaaaatttacgcttacctttcccgctaa

DBGET integrated database retrieval system