KEGG   Escherichia coli O17 K52 H18 UMN026 (ExPEC): ECUMN_2629Help
Entry
ECUMN_2629        CDS       T00831                                 

Gene name
yfbQ
Definition
aminotransferase AlaT
Orthology
K14260  
alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
eum  Escherichia coli O17:K52:H18 UMN026 (ExPEC)
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:eum00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    ECUMN_2629 (yfbQ)
   01230 Biosynthesis of amino acids
    ECUMN_2629 (yfbQ)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ECUMN_2629 (yfbQ)
   00290 Valine, leucine and isoleucine biosynthesis
    ECUMN_2629 (yfbQ)
Enzymes [BR:eum01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     ECUMN_2629 (yfbQ)
    2.6.1.66  valine---pyruvate transaminase
     ECUMN_2629 (yfbQ)
Amino acid related enzymes [BR:eum01007]
 Aminotransferase (transaminase)
  Class I
   ECUMN_2629 (yfbQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2706903..2708120
Genome map
AA seq 405 aa AA seqDB search
MSPIEKSSKLENVCYDIRGPVLKEAKRLEEEGNKVLKLNIGNPAPFGFDAPDEILVDVIR
NLPTAQGYCDSKGLYSARKAIMQHYQARGMRDVTVEDIYIGNGVSELIVQAMQALLNSGD
EMLVPAPDYPLWTAAVSLSSGKAVHYLCDESSDWFPDLDDIRAKITPRTRGIVIINPNNP
TGAVYSKELLMEIVEIARQHNLIIFADEIYDKILYDDAEHHSIAPLAPDLLTITFNGLSK
TYRVAGFRQGWMVLNGPKKHAKGYIEGLEMLASMRLCANVPAQHAIQTALGGYQSISEFI
TPGGRLYEQRNRAWELINDIPGVSCVKPRGALYMFPKIDAKRFNIHDDQKMVLDFLLQEK
VLLVQGTAFNWPWPDHFRIVTLPRVDDIELSLSKFARFLSGYHQL
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgtcccccattgaaaaatccagcaaattagagaatgtctgttacgacatccgtggtccg
gtgctgaaagaagcaaaacgcctggaagaagaaggtaacaaggtactgaaactgaacatc
ggcaaccctgccccgttcggttttgacgcgccagatgaaatcctcgttgacgtgattcgc
aacctgcctaccgctcaagggtattgcgattccaaagggctttactccgcgcgtaaagcc
atcatgcagcactaccaggctcgtggcatgcgtgatgttaccgtggaagatatttacatc
ggcaatggtgtatcggagcttatcgttcaggcaatgcaggcattgctgaacagcggcgac
gaaatgttggttcctgcacctgattacccactatggaccgcggcggtttcgctctccagc
ggtaaagcggtgcattatctttgcgatgaatcctctgactggttcccggaccttgatgat
attcgcgctaaaattacgcctcgtacgcgtgggatcgttattatcaacccaaataaccca
actggcgcggtatattccaaagagcttttaatggagatagtggagattgcacgtcagcat
aatctcattatcttcgccgatgaaatttatgacaaaattctctacgacgacgctgagcat
cactcaattgcgccgctggcacctgatctgctgactattacctttaacggactgtcgaaa
acgtaccgcgttgctggcttccgtcaggggtggatggtgttgaacgggccgaaaaaacac
gccaaaggttacatcgaaggtctggaaatgctggcctcaatgcgcctgtgtgctaacgtt
cctgcgcaacacgccattcagaccgcgctgggcggttatcagagcatcagtgaatttatt
acccctggcggtcgtctttatgagcagcgtaaccgcgcatgggaattgatcaatgatatt
ccgggcgtttcctgcgtgaaaccgcgcggtgcgctgtacatgttcccgaaaatcgacgcc
aaacgctttaatattcacgacgatcagaaaatggtgctggatttcctgttgcaggaaaaa
gttctgttggtgcaagggacggcattcaactggccgtggccggatcacttccgcattgtc
acgctaccgcgtgtcgatgatatcgagctgtctttgagcaagttcgcgcgtttcctttct
ggttatcatcagctgtaa

DBGET integrated database retrieval system