KEGG   Escherichia coli O17 K52 H18 UMN026 (ExPEC): ECUMN_2718Help
Entry
ECUMN_2718        CDS       T00831                                 

Gene name
glk
Definition
(RefSeq) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
eum  Escherichia coli O17:K52:H18 UMN026 (ExPEC)
Pathway
eum00010  Glycolysis / Gluconeogenesis
eum00052  Galactose metabolism
eum00500  Starch and sucrose metabolism
eum00520  Amino sugar and nucleotide sugar metabolism
eum00521  Streptomycin biosynthesis
eum01100  Metabolic pathways
eum01110  Biosynthesis of secondary metabolites
eum01120  Microbial metabolism in diverse environments
eum01130  Biosynthesis of antibiotics
eum01200  Carbon metabolism
Module
eum_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
eum_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:eum00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ECUMN_2718 (glk)
   00052 Galactose metabolism
    ECUMN_2718 (glk)
   00500 Starch and sucrose metabolism
    ECUMN_2718 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    ECUMN_2718 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    ECUMN_2718 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    ECUMN_2718 (glk)
Enzymes [BR:eum01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     ECUMN_2718 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase PaaX_C
Motif
Other DBs
NCBI-GeneID: 7159575
NCBI-ProteinID: YP_002413425
UniProt: B7N5Y9
Structure
PDB: 

Jmol
Position
complement(2801044..2802009)
Genome map
AA seq 321 aa AA seqDB search
MTKYALVGDVGGTNARLALCDIASGEISQAKTYSGLDYPSLEAVIRVYLEEHKVEVKDGC
IAIACPITGDWVAMTNHTWAFSIAEMKKNLGFSHLEIINDFTAVSMAIPMLKKEHLIQFG
GAEPVEGKPIAVYGAGTGLGVAHLVHVDKRWVSLPGEGGHVDFAPNSEEEAIILEILRAE
IGHVSAERVLSGPGLVNLYRAIVKADNRLPENLKPKDITERALADSCTDCRRALSLFCVI
MGRFGGNLALNLGTFGGVFIAGGIVPRFLEFFKASGFRAAFEDKGRFKEYVHDIPVYLIV
HDNPGLLGSGAHLRQTLGHIL
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgacaaagtatgcattagtcggtgatgtgggcggcaccaacgcacgtcttgctctgtgt
gatattgccagtggtgaaatctcgcaggctaagacctattcagggcttgattaccccagc
ctcgaagcggtcattcgcgtttatcttgaagaacataaggtcgaggtgaaagacggctgt
attgccatcgcttgcccaattaccggtgactgggtggcaatgaccaaccatacctgggcg
ttctcaattgccgaaatgaaaaagaatctcggttttagccatctggaaattattaacgat
tttaccgctgtatcgatggcgatcccgatgctgaaaaaagagcatctgattcagtttggt
ggcgcagaaccggtcgaaggtaagcctattgcggtttacggtgccggaacggggcttggg
gttgcgcatctggtccatgtcgataagcgttgggtaagcttgccaggcgaaggcggtcac
gttgattttgcgccgaacagtgaagaagaggccattatcctcgaaatactgcgtgcagaa
attggtcatgtttcggcagagcgcgtgctttctggcccaggactggtgaatttgtatcgc
gcgattgtgaaagccgacaaccgcctgccagaaaatctcaagccaaaagatattaccgaa
cgtgcgctggctgacagctgcaccgattgccgccgcgcgttgtcgctgttttgcgtcatt
atgggccgttttggcggcaatctggcgctcaatctcgggacatttggcggcgtgtttatt
gcgggtggtatcgtgccgcgcttccttgagttcttcaaagcctctggtttccgtgccgca
tttgaagataaagggcgctttaaagaatatgtccatgatattccggtgtatctcatcgtc
catgacaatccgggccttcttggttccggtgcacatttacgccagaccttaggtcacatt
ctgtaa

DBGET integrated database retrieval system