KEGG   Escherichia coli O17 K52 H18 UMN026 (ExPEC): ECUMN_3146Help
Entry
ECUMN_3146        CDS       T00831                                 

Gene name
recD
Definition
exonuclease V subunit alpha (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
eum  Escherichia coli O17:K52:H18 UMN026 (ExPEC)
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:eum03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3257258..3259084)
Genome map
AA seq 608 aa AA seqDB search
MKLQKQLLEAVEHKQLRPLDVQFALTVAGDEHPAVTLAAALLSHDAGEGHVCLPLSRLEN
NEESHPLLATCVSEIGELQNWEECLLASQAVSRGDEPTPMILCGDRLYLNRMWCNERTVA
RFFNEVNHAIEVDEALLAQTLDKLFPVSDEINWQKVAAAVALTRRISVISGGPGTGKTTT
VAKLLAALIQMADGERCRIRLAAPTGKAAARLTESLGKALRQLPLTDEQKKRIPEDASTL
HRLLGAQPGSQRLRHHAGNPLHLDVLVVDEASMIDLPMMSRLIDALPDHARVIFLGDRDQ
LASVEAGAVLGDICAYANAGFTAERAGQLSRLTGTHVPAGTGTEAASLRDSLCLLQKSYR
FGSDSGIGQLAAAINRGDKTAVKTVFQQDFSDIEKRLLQSGEDYIAMLEEALAGYGRYLD
LLQARAEPDLIIQAFNEYQLLCALREGPFGVAGLNERIEQFMQQKRKIHRNPHSRWYEGR
PVMIARNDSALGLFNGDIGIALDRGQGTRVWFAMPDGNIKSVQPSRLPEHETTWAMTVHK
SQGSEFDHAALILPSQRTPVVTRELVYTAVTRARRRLSLYADERILSAAIATRTERRSGL
AALFSSRG
NT seq 1827 nt NT seq  +upstreamnt  +downstreamnt
atgaaattgcaaaagcaattactggaagctgtggagcacaaacagctacgcccgctggat
gtgcaatttgccctgaccgtggcgggagatgaacatcctgccgtcaccctcgcggcagcc
ctgttaagccacgacgccggggaagggcatgtctgtttaccgctctcacgactggaaaat
aacgaggagtcacatccgctgttagcaacctgtgtcagtgaaatcggtgagttacaaaat
tgggaagaatgcttgctggcttcacaagcggtcagccggggagatgaaccaacgccgatg
atcctctgtggtgatcgtctttatttgaatcgcatgtggtgtaacgagcgcacagtggca
cgctttttcaacgaagtgaatcatgccattgaggttgatgaagctctactggcgcaaacc
ctggacaaactttttccagtaagcgatgaaattaactggcaaaaagttgcggcggcagtg
gcgctgacgcggcggatctcggtgatttccggcggccctggcaccggtaaaacgaccacc
gtagcgaagttgctggcagcgttaattcaaatggcagacggcgaacgctgccgtatccgt
ctggctgcaccaacgggtaaagctgccgcgcgcttaaccgaatctctcggcaaggctttg
cgccagttaccgctgaccgatgaacaaaagaaacgcattccggaagatgccagcactttg
caccgattgctgggtgcgcagccgggtagccagcgtttacgtcatcatgccggtaacccg
ctgcatcttgatgtgctggtggtagatgaagcgtcaatgatcgatctgcctatgatgtcg
agactgatcgacgccttgcccgatcatgcgcgagtgatctttctcggcgatcgtgatcaa
ctggcttcggttgaggctggggcagtgctgggcgatatctgcgcttatgccaatgccggc
tttaccgccgagcgtgccgggcagttgagccgcctgacgggaactcacgttccggcagga
actggcacagaagcggcatctttgcgcgacagtctctgcctgctgcaaaaaagctatcgt
ttcggcagcgattctggcattggtcagttagctgcggcgatcaaccgtggtgataaaacg
gcagtgaaaaccgtttttcagcaggatttttctgatatcgaaaaacggcttttacagagc
ggcgaagattatattgcgatgcttgaggaagctcttgcgggttacggacgttatctggat
ctgctgcaagcgcgtgccgagccggatttaatcattcaggcgttcaatgagtaccagctt
ttgtgcgccctgcgggaagggccgtttggcgtggctggactgaatgagcgaattgagcag
tttatgcaacagaagcgcaaaattcatcgtaatccgcactctcgttggtacgaaggccga
ccggtgatgattgcccgtaatgacagcgcgcttgggttgtttaatggcgatatcggtatc
gctctggatcgtgggcaggggacgcgcgtctggtttgcgatgccggacggcaatattaag
tctgtgcaaccgagtcgcttgccagagcacgaaactacgtgggcgatgacggtacataaa
tcgcagggatcggagttcgaccatgcggcgttgattttaccgagccaacgcacgccggta
gtaacacgagagctggtttacaccgcggtgacccgcgcgcgtcgccgtctgtcgctgtat
gccgatgagcgcattttaagtgcggcaattgccacgcgcaccgagcggcgcagcggtctg
gcggcgttgtttagttcacggggataa

DBGET integrated database retrieval system