KEGG   Escherichia coli O17 K52 H18 UMN026 (ExPEC): ECUMN_3243Help
Entry
ECUMN_3243        CDS       T00831                                 

Gene name
bglA
Definition
6-phospho-beta-glucosidase A (EC:3.2.1.86)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
eum  Escherichia coli O17:K52:H18 UMN026 (ExPEC)
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:eum00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ECUMN_3243 (bglA)
Enzymes [BR:eum01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     ECUMN_3243 (bglA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3366101..3367540
Genome map
AA seq 479 aa AA seqDB search
MIVKKLTLPKDFLWGGAVAAHQVEGGWNKGGKGPSICDVLTGGAHGVPREITKEVLPGKY
YPNHEAVDFYGHYKEDIKLFAEMGFKCFRTSIAWTRIFPKGDEAQPNEEGLKFYDDMFDE
LLKYNIEPVITLSHFEMPLHLVQQYGSWTNRKVVDFFVRFAEVVFERYKHKVKYWMTFNE
INNQRNWRAPLFGYCCSGVVYTEHENPEETMYQVLHHQFVASALAVKAARRINPEMKVGC
MLAMVPLYPYSCNPDDVMFAQESMRERYVFTDVQLRGYYPSYVLHEWERRGFNIKMEDGD
LDVLREGTCDYLGFSYYMTNAVKAEGGTGDAISGFEGSVPNPYVKASDWGWQIDPVGLRY
ALCELYERYQKPLFIVENGFGAYDKVEEDGSINDDYRIDYLRAHIEEMKKAVTYDGVDLM
GYTPWGCIDCVSFTTGQYSKRYGFIYVNKHDDGTGDMSRSRKKSFDWYKEVIASNGENL
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgatagtgaaaaaactcaccttaccgaaagatttcttatggggcggcgcagttgccgct
catcaggtcgaaggcggctggaacaaaggcggcaaagggccgagcatttgtgacgttctg
accggtggcgcacacggcgtgccgcgcgaaatcaccaaagaagtgttgccaggaaaatac
tatccgaaccatgaagccgttgatttttatggtcattacaaggaagacatcaagctattt
gccgaaatgggcttcaaatgttttcgtacatccatcgcctggacgcgcatttttccaaaa
ggcgatgaagctcagccaaacgaagaagggctgaagttctacgatgatatgttcgatgaa
ctgctgaaatacaacatcgaaccggtgatcaccctctcccactttgaaatgccgctgcat
ctggtgcagcaatacggtagctggaccaaccgtaaagtggttgatttctttgtccgtttc
gcagaagtggtatttgaacgctataagcataaagtcaaatactggatgaccttcaacgaa
attaacaaccagcgtaactggcgtgcaccgctgttcggttactgctgctccggcgtggtg
tataccgagcatgaaaacccggaagagacgatgtaccaggtgctgcatcaccagtttgtc
gccagcgccctggcggtgaaagccgcgcgtcgcattaacccggaaatgaaagtcggctgt
atgctggcgatggtgccgctttacccttactcctgtaatccggacgatgtgatgttcgcc
caggagtcgatgcgcgaacgctacgtctttaccgatgtgcaactgcgtggctattacccg
tcctatgtgttgcacgagtgggagcgtcgcggatttaacatcaaaatggaagacggcgat
ctcgatgtgctgcgcgaaggcacctgcgattatctcggtttcagctattacatgaccaac
gcggtgaaggccgaaggcggcaccggcgatgcgatctctggttttgaaggcagcgtacca
aacccgtatgttaaagcatctgactggggctggcagattgatccggtgggtctgcgttac
gcactttgcgaactgtatgagcgttaccagaagccgctgtttattgtcgaaaacggtttt
ggcgcttacgacaaagtggaagaagatggcagcatcaacgacgactaccgcattgactac
ctgcgcgcccatattgaagagatgaaaaaagcggtgacttacgatggtgtcgacctgatg
ggctacacaccatggggctgcatcgactgcgtgtcgttcaccaccgggcagtacagcaag
cgctacggctttatctatgtgaataaacatgacgacggtactggcgatatgtcgcgttca
cgtaagaagagctttgactggtacaaagaggtgattgccagcaacggcgagaatctgtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system