KEGG   Escherichia coli O17 K52 H18 UMN026 (ExPEC): ECUMN_3451Help
Entry
ECUMN_3451        CDS       T00831                                 

Gene name
glcB
Definition
malate synthase G (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
eum  Escherichia coli O17:K52:H18 UMN026 (ExPEC)
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:eum00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ECUMN_3451 (glcB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    ECUMN_3451 (glcB)
   00630 Glyoxylate and dicarboxylate metabolism
    ECUMN_3451 (glcB)
Enzymes [BR:eum01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     ECUMN_3451 (glcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3571357..3573528)
Genome map
AA seq 723 aa AA seqDB search
MSETITQGLLRIDADFKRFVDEEVLPGVELDAAAFWRNVDEIVHDLAPENRQLLAERDRI
QAALDEWHRSNPGPVKDKAAYKSFLCELGYLVPQPERVTVETTGIDSEITSQAGPQLVVP
AMNARYALNAANARWGSLYDALYGSDIIPQEGAMVSGYDPQRGEQVIAWVRRFLDESLPL
ENGSYQDVVAFKVVDKQLRIQLKNGKETTLRTPAQFIGYRGNAAAPSCILLKNNGLHIEL
QIDANGRIGKDDPAHINDVIVEAAISTILDCEDSVAAVDAEDKILLYRNLLGLMQGTLQE
KMEKNGRQIVRKLNDDRQYTAADGSEISLHGRSLLFIRNVGHLMTIPVIWDSEGNEIPEG
ILDGVMTSAIALYDLKVQKNSRTGSVYIVKPKMHGPQEVAFANKLFTRIETMLGMAPNTL
KMGIMDEERRTSLNLRSCIAQARNRVAFINTGFLDRTGDEMHSVMEAGPMLRKNQMKSTP
WIKAYERNNVLSGLFCGLRGKAQIGKGMWAMPDLMADMYSQKGDQLRAGANTAWVPSPTA
ATLHALHYHQTNVQSVQANIAQSEFNAEFEPLLDDLLTIPVAENANWSVEEIQQELDNNV
QGILGYVVRWVEQGIGCSKVPDIHNVALMEDRATLRISSQHIANWLRHGILTKEQVQASL
ENMAKVVDQQNAGDPAYRPMAGNFANSCAFKAASDLIFLGVKQPNGYTEPLLHAWRLREK
ESH
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaaaccataacccaaggccttttacgcattgacgccgactttaaacgttttgtg
gatgaagaagttttgccgggcgtagaactggatgctgccgcgttctggcgcaatgttgat
gagattgttcacgatctggcaccagaaaatcgtcagttgctggcagaacgcgatcgcatt
caggcagcgcttgatgagtggcatcgcagcaatccggggccggtaaaagataaagcggcc
tataaatctttcctgtgtgaactgggctacctggtgccgcaaccggagcgcgtgacggtg
gaaaccacgggcattgacagcgaaatcaccagccaggcggggccacagctggtggttccg
gcaatgaatgcccgctacgcgctgaacgcggcgaacgcgcgctggggctcactgtacgat
gcgttatacggcagcgacatcatcccgcaggaaggggcgatggtcagcggctacgatccg
cagcgcggtgagcaggttatcgcctgggttcggcgtttcctcgatgaatctctaccgctg
gaaaacggcagctatcaggatgtggtggcgtttaaggtggttgataaacaattacgcatc
cagttgaaaaatggtaaagaaaccacgttacgcaccccggcgcagtttatcggttaccgt
ggcaatgccgctgcgccgtcctgcattttgctgaaaaataacggcctgcatattgagctg
caaatcgatgccaacgggcggattggcaaagacgatccggcgcatatcaacgatgttatc
gtcgaagcggccatcagtaccattctcgactgcgaagattcggtcgcggcggttgatgcg
gaagataaaatcctgctgtaccgcaacctgctgggcctgatgcaggggactctgcaagag
aaaatggagaaaaacggtcggcaaatcgtgcgtaaactgaatgacgatcgtcagtacacc
gccgccgatggctctgaaatttctctgcacggacgctcgttgctgtttatccgcaacgtg
gggcatttgatgaccattcctgtgatttgggacagcgaaggcaatgaaatcccggaaggc
attcttgatggcgtcatgactagcgcgattgccctctatgatttaaaagtgcagaaaaac
tcgcgcactggcagcgtctatattgtgaaaccgaaaatgcacggtccgcaggaagtggcg
ttcgccaacaaactgtttacccgcattgagacaatgctcggtatggcaccgaataccctg
aaaatgggcattatggatgaagaacgtcggacctcgctgaacttgcgtagctgtatcgct
caggcgcgcaaccgcgtggcgttcatcaataccggtttcctcgaccgtaccggcgatgaa
atgcattcggtgatggaagctggcccgatgctgcgtaaaaaccagatgaaatcgacgccg
tggatcaaagcctacgagcgtaataacgtgctttccggtctgttctgtgggctgcgcggt
aaagcgcaaattggtaaaggcatgtgggcaatgccggacctgatggcagacatgtacagc
cagaagggcgaccaactgcgtgccggggcaaacacagcctgggttccgtcaccaaccgct
gctacgctccatgcgctgcactaccaccaaaccaacgtacagagcgtgcaggccaacatt
gcccagagcgagttcaatgctgaatttgaaccgttgctggacgatctgctgactattccg
gtggctgaaaacgctaactggtcggtggaagagatccaacaagagctggataacaacgtg
caggggattctggggtacgtggtgcgttgggtggagcaggggattggttgttcaaaagtg
ccggatattcacaacgtggcgctgatggaagaccgcgcaacgctgcgtatctccagccag
catatcgccaactggttacgtcacggtattctgaccaaagaacaggtgcaggcgtcgctg
gagaatatggcgaaagtggttgatcagcaaaacgctggcgatccggcttatcgtccgatg
gcggggaatttcgctaactcgtgtgcttttaaagctgccagcgatttaatcttcctcggc
gtgaaacagccaaacggctataccgaaccgttattacacgcctggcgtttacgcgaaaaa
gaaagtcattaa

DBGET integrated database retrieval system