KEGG   Escherichia coli O17 K52 H18 UMN026 (ExPEC): ECUMN_4370Help
Entry
ECUMN_4370        CDS       T00831                                 

Gene name
fadB
Definition
(RefSeq) fatty acid oxidation complex subunit alpha FadB
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
eum  Escherichia coli O17:K52:H18 UMN026 (ExPEC)
Pathway
eum00071  Fatty acid degradation
eum00280  Valine, leucine and isoleucine degradation
eum00281  Geraniol degradation
eum00310  Lysine degradation
eum00362  Benzoate degradation
eum00380  Tryptophan metabolism
eum00410  beta-Alanine metabolism
eum00640  Propanoate metabolism
eum00650  Butanoate metabolism
eum00903  Limonene and pinene degradation
eum00930  Caprolactam degradation
eum01040  Biosynthesis of unsaturated fatty acids
eum01100  Metabolic pathways
eum01110  Biosynthesis of secondary metabolites
eum01120  Microbial metabolism in diverse environments
eum01130  Biosynthesis of antibiotics
eum01200  Carbon metabolism
eum01212  Fatty acid metabolism
Module
eum_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:eum00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    ECUMN_4370 (fadB)
   00650 Butanoate metabolism
    ECUMN_4370 (fadB)
  Lipid metabolism
   00071 Fatty acid degradation
    ECUMN_4370 (fadB)
   01040 Biosynthesis of unsaturated fatty acids
    ECUMN_4370 (fadB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ECUMN_4370 (fadB)
   00310 Lysine degradation
    ECUMN_4370 (fadB)
   00380 Tryptophan metabolism
    ECUMN_4370 (fadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ECUMN_4370 (fadB)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    ECUMN_4370 (fadB)
   00281 Geraniol degradation
    ECUMN_4370 (fadB)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ECUMN_4370 (fadB)
   00930 Caprolactam degradation
    ECUMN_4370 (fadB)
Enzymes [BR:eum01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     ECUMN_4370 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     ECUMN_4370 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     ECUMN_4370 (fadB)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     ECUMN_4370 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-GeneID: 7156302
NCBI-ProteinID: YP_002414996
UniProt: B7NFE7
Position
complement(4515441..4517630)
Genome map
AA seq 729 aa AA seqDB search
MLYKGDTLYLDWLEDGIAELVFDAPGSVNKLDTATVASLGEAIGVLEQQSDLKGLLLRSN
KAAFIVGADITEFLSLFLVPEEQLSQWLHFANSVFNRLEDLPVPTIAAVNGYALGGGCEC
VLATDYRLATPDLRIGLPETKLGIMPGFGGSVRMPRMLGADSALEIIAAGKDVGADQALK
IGLVDGVVKAEKLVEGAMAILRQAINGDLDWKAKRQPKLEPLKLSKIEATMSFTIAKGMV
AQTAGKHYPAPITAVKTIEAAARFGREEALNLENKSFVPLAHTNEARALVGIFLNDQYVK
GKAKKLTKDVETPKQAAVLGAGIMGGGIAYQSAWKGVPVVMKDINDKSLTLGMTEAAKLL
NKQLERGKIDGLKLAGVISTIHPTLDYAGFDRVDIVVEAVVENPKVKKAVLAETEQKVRP
DTVLASNTSTIPISELANALERPENFCGMHFFNPVHRMPLVEIIRGEKSSDETIAKVVAW
ASKMGKTPIVVNDCPGFFVNRVLFPYFAGFSQLLRDGADFRKIDKVMEKQFGWPMGPAYL
LDVVGIDTAHHAQAVMAAGFPQRMQKDYRDAIDALFDANRFGQKNGLGFWRYKEDSKGKP
KKEEDAAVDDLLAEVSQPKRDFSEEEIIARMMIPMVNEVVRCLEEGIIATPAEADMALVY
GLGFPPFHGGAFRWLDTLGSAKYLDMAQQYQHLGPLYEVPEGLRNKARHNEPYYPPVEPA
RPVGDLKTA
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgctttacaaaggcgacaccctgtaccttgactggctggaagatggcattgccgaactg
gtatttgatgccccaggttcagttaataaactcgacactgccaccgtcgccagcctcggc
gaggccatcggcgtgctggaacagcaatcagatctaaaagggctgctgctgcgttcgaac
aaagcagcctttatcgtcggtgctgatatcaccgaatttttgtctctgttcctcgttcct
gaagaacagttaagtcagtggctgcactttgccaatagcgtgtttaatcgcctggaagat
ctgccggtgccgaccattgctgccgtcaacggctatgcgctgggcggtggctgcgaatgc
gtgctggcgaccgattatcgtctggcgacgccggatctgcgcatcggtctgccggaaacc
aaactgggcatcatgccgggctttggcggttctgtacgtatgccacgtatgctgggcgct
gacagtgcgctggaaatcattgccgccggtaaagatgtcggcgcggatcaggcgctgaaa
atcggtctggtggatggtgtagtcaaagcagaaaaactggttgaaggggcgatggcgatt
ttacgccaggccattaacggcgacctcgactggaaagcgaaacgtcagccgaagctggaa
ccgctaaaactgagcaagattgaagccaccatgagtttcaccatcgctaaagggatggtc
gcacaaacggcggggaaacattatccggcccccatcaccgcagtaaaaaccattgaagcg
gcggcccgttttggtcgtgaagaagccttaaatctggaaaacaaaagttttgtcccgctg
gcgcataccaacgaagctcgcgcactggtcggcattttccttaacgatcaatatgtaaaa
ggcaaagcgaagaaactcaccaaagacgttgaaaccccaaaacaggccgctgtgctgggc
gcaggcattatgggcggcggcatcgcttaccagtctgcgtggaaaggcgtgccggttgtc
atgaaagatatcaacgacaagtcgttaaccctcggcatgaccgaagccgcgaaactgctg
aacaagcagcttgagcgcggcaagatcgatggtctgaaactggctggcgtgatctctaca
atccacccaacgctcgactacgccgggtttgaccgcgtggatattgtggtagaagcggtt
gtcgaaaacccgaaagtgaaaaaagccgtactggcagaaaccgaacaaaaagtacgcccg
gataccgtgctggcgtctaacacttcaaccattcctatcagcgaactggccaacgcgctg
gaacgcccggaaaacttctgcgggatgcacttctttaacccggtgcaccggatgccgttg
gtagaaattattcgcggcgagaaaagctccgacgaaaccatcgcgaaagtcgtcgcatgg
gcgagcaagatgggaaagacgccgattgtggtcaacgactgccccggcttcttcgttaac
cgtgtactgttcccctacttcgccggattcagccagttgctgcgcgacggcgcggatttc
cgcaagatcgacaaagtgatggaaaaacagtttggctggccgatgggtccggcatatctg
ctggacgttgtgggcattgacaccgcgcatcatgcccaggctgtcatggcagcaggcttc
ccgcagcggatgcagaaagattatcgcgatgccatcgacgcgctgtttgatgccaaccgc
tttggtcagaagaacggcctcggtttctggcgttataaagaagacagcaaaggtaagccg
aagaaagaagaagacgccgctgttgacgacctgctggcagaagtgagccagccgaagcgc
gatttcagcgaagaagagattatcgcccgcatgatgatcccgatggtcaacgaagtggtg
cgctgtctggaagaaggcattatcgccactccggcagaagcggatatggcgctggtctac
ggcctgggtttccctccgttccacggtggcgcgttccgctggctggacaccctcggtagc
gcaaaatacctcgatatggcacagcaatatcagcacctcggcccactgtacgaagtgccg
gaaggtctgcgtaataaagcgcgtcataacgaaccgtactatcccccggttgagccagcc
cgtccggttggcgacctgaaaacggcttaa

DBGET integrated database retrieval system